Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SK68

Protein Details
Accession A0A5C2SK68   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-30RLYSKGRVLGHKRAKRNTRPNTSLLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 3.5, cyto_nucl 3.833, mito 20.5, mito_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MRWCCRLYSKGRVLGHKRAKRNTRPNTSLLQIEGVSNKEEAQFYLGKRVAYVYRAKREIQGSKVRVIWGRVTRPHGNSGVVKGKFRSNLPPHAFGASVRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.73
4 0.74
5 0.75
6 0.81
7 0.82
8 0.86
9 0.85
10 0.85
11 0.81
12 0.76
13 0.7
14 0.63
15 0.54
16 0.43
17 0.35
18 0.25
19 0.21
20 0.19
21 0.15
22 0.13
23 0.12
24 0.11
25 0.1
26 0.1
27 0.1
28 0.11
29 0.13
30 0.12
31 0.19
32 0.2
33 0.19
34 0.19
35 0.2
36 0.18
37 0.18
38 0.26
39 0.24
40 0.28
41 0.3
42 0.31
43 0.33
44 0.38
45 0.39
46 0.38
47 0.41
48 0.37
49 0.38
50 0.39
51 0.37
52 0.33
53 0.31
54 0.31
55 0.28
56 0.31
57 0.33
58 0.38
59 0.42
60 0.42
61 0.44
62 0.39
63 0.37
64 0.33
65 0.35
66 0.37
67 0.33
68 0.33
69 0.31
70 0.34
71 0.34
72 0.35
73 0.39
74 0.37
75 0.46
76 0.49
77 0.52
78 0.49
79 0.47
80 0.45
81 0.35
82 0.34
83 0.25
84 0.2
85 0.16
86 0.15
87 0.13