Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2SG98

Protein Details
Accession A0A5C2SG98    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-52GIRHKLFVPRPPRVRRPSARYPCPVSPHydrophilic
71-90LYLTRRRTPDQRQLPPPPPTHydrophilic
NLS Segment(s)
PositionSequence
205-211RARARAR
Subcellular Location(s) mito 14, plas 4, extr 4, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFTYPPSLLPASTYCVPLTTRYFFLGIRHKLFVPRPPRVRRPSARYPCPVSPDTPGLPLKPVRVHACSSRLYLTRRRTPDQRQLPPPPPTVPDRPLIAIAPASPTARRCDGCVRTMASGTPNPSLSPMQHARAAYNGNMLRLRASQPQPGCAGCLGLVSRVSRYSCSLSRLPLPQTQSSLARSVRLTASPHADGELPRSAFARARARARARVRSEFRVRPSPPWSWLVETPRYPGIRYPLPDVGSPLTLPGPMPRTAWTAGCRSWRCVPCSVLLRASVRGRIYARPPVCVCVCHTPCPCRLSHPHPKSLPLPRSGLVRTHSPSPPIRSSPLFLAPPYAVRHSPPFVSPHSSHCACLETRAAQLVVQRGSASSHSFVPPGGVVFIIMLACLSPCVSVVLVEKYYYAAAYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.23
4 0.25
5 0.29
6 0.27
7 0.27
8 0.27
9 0.29
10 0.28
11 0.34
12 0.39
13 0.4
14 0.41
15 0.42
16 0.42
17 0.47
18 0.51
19 0.53
20 0.52
21 0.55
22 0.61
23 0.67
24 0.76
25 0.77
26 0.83
27 0.84
28 0.84
29 0.85
30 0.86
31 0.85
32 0.83
33 0.81
34 0.76
35 0.73
36 0.67
37 0.58
38 0.53
39 0.49
40 0.43
41 0.42
42 0.38
43 0.32
44 0.35
45 0.35
46 0.34
47 0.33
48 0.37
49 0.36
50 0.37
51 0.4
52 0.4
53 0.43
54 0.41
55 0.39
56 0.39
57 0.39
58 0.41
59 0.46
60 0.5
61 0.54
62 0.58
63 0.62
64 0.65
65 0.7
66 0.75
67 0.77
68 0.77
69 0.77
70 0.79
71 0.81
72 0.78
73 0.73
74 0.65
75 0.58
76 0.54
77 0.52
78 0.46
79 0.41
80 0.37
81 0.34
82 0.33
83 0.3
84 0.24
85 0.18
86 0.15
87 0.14
88 0.14
89 0.13
90 0.14
91 0.15
92 0.18
93 0.22
94 0.22
95 0.23
96 0.31
97 0.34
98 0.35
99 0.37
100 0.35
101 0.32
102 0.32
103 0.3
104 0.24
105 0.23
106 0.23
107 0.21
108 0.2
109 0.18
110 0.2
111 0.2
112 0.17
113 0.22
114 0.23
115 0.23
116 0.26
117 0.26
118 0.24
119 0.25
120 0.27
121 0.19
122 0.23
123 0.21
124 0.2
125 0.21
126 0.21
127 0.19
128 0.19
129 0.22
130 0.22
131 0.24
132 0.28
133 0.28
134 0.31
135 0.31
136 0.29
137 0.27
138 0.19
139 0.17
140 0.11
141 0.11
142 0.09
143 0.08
144 0.09
145 0.09
146 0.1
147 0.11
148 0.12
149 0.12
150 0.14
151 0.18
152 0.18
153 0.22
154 0.23
155 0.23
156 0.26
157 0.29
158 0.3
159 0.3
160 0.31
161 0.28
162 0.29
163 0.29
164 0.27
165 0.25
166 0.26
167 0.22
168 0.21
169 0.19
170 0.19
171 0.18
172 0.18
173 0.18
174 0.15
175 0.19
176 0.17
177 0.17
178 0.16
179 0.16
180 0.14
181 0.15
182 0.17
183 0.14
184 0.13
185 0.14
186 0.14
187 0.14
188 0.19
189 0.23
190 0.23
191 0.27
192 0.33
193 0.35
194 0.43
195 0.47
196 0.51
197 0.49
198 0.54
199 0.55
200 0.56
201 0.61
202 0.57
203 0.57
204 0.57
205 0.53
206 0.49
207 0.5
208 0.45
209 0.4
210 0.38
211 0.35
212 0.29
213 0.32
214 0.32
215 0.31
216 0.29
217 0.28
218 0.29
219 0.29
220 0.26
221 0.24
222 0.24
223 0.24
224 0.24
225 0.27
226 0.26
227 0.27
228 0.26
229 0.26
230 0.23
231 0.19
232 0.17
233 0.14
234 0.1
235 0.09
236 0.09
237 0.1
238 0.11
239 0.12
240 0.13
241 0.14
242 0.17
243 0.18
244 0.2
245 0.2
246 0.21
247 0.23
248 0.3
249 0.3
250 0.31
251 0.39
252 0.41
253 0.42
254 0.42
255 0.41
256 0.38
257 0.42
258 0.4
259 0.33
260 0.31
261 0.3
262 0.3
263 0.3
264 0.29
265 0.24
266 0.25
267 0.26
268 0.27
269 0.29
270 0.34
271 0.33
272 0.35
273 0.35
274 0.36
275 0.35
276 0.32
277 0.31
278 0.33
279 0.35
280 0.37
281 0.41
282 0.41
283 0.45
284 0.46
285 0.43
286 0.39
287 0.44
288 0.46
289 0.53
290 0.55
291 0.59
292 0.58
293 0.62
294 0.63
295 0.65
296 0.62
297 0.55
298 0.51
299 0.44
300 0.47
301 0.44
302 0.41
303 0.33
304 0.34
305 0.33
306 0.35
307 0.36
308 0.36
309 0.4
310 0.43
311 0.46
312 0.43
313 0.45
314 0.41
315 0.42
316 0.4
317 0.41
318 0.36
319 0.3
320 0.3
321 0.26
322 0.27
323 0.28
324 0.28
325 0.23
326 0.24
327 0.29
328 0.28
329 0.3
330 0.28
331 0.29
332 0.29
333 0.36
334 0.34
335 0.35
336 0.4
337 0.4
338 0.38
339 0.35
340 0.35
341 0.28
342 0.3
343 0.28
344 0.22
345 0.23
346 0.24
347 0.23
348 0.21
349 0.24
350 0.26
351 0.23
352 0.22
353 0.2
354 0.18
355 0.2
356 0.21
357 0.21
358 0.17
359 0.19
360 0.2
361 0.2
362 0.2
363 0.19
364 0.18
365 0.15
366 0.14
367 0.1
368 0.09
369 0.09
370 0.09
371 0.07
372 0.06
373 0.05
374 0.05
375 0.05
376 0.05
377 0.05
378 0.05
379 0.05
380 0.07
381 0.07
382 0.09
383 0.13
384 0.17
385 0.18
386 0.18
387 0.18
388 0.18
389 0.18