Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2S0Y8

Protein Details
Accession A0A5C2S0Y8   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
123-146SEVRKSPTPRPSLRKQRRPSLIEQHydrophilic
NLS Segment(s)
PositionSequence
136-137RK
Subcellular Location(s) cyto_nucl 11.5, mito 5, nucl 20.5
Family & Domain DBs
Amino Acid Sequences MPRDASPPELSSLERTALWVQAQTAFAQSSAETSPLSPSRSSKTTDSSYRTTMSSDGVSLKPSLARSSSMQQSTHTRPPSAKNNQRPRYDSRTRRSSLPFPQSPPGSGYPIPLEVAAPHPPESEVRKSPTPRPSLRKQRRPSLIEQIISIGSPGQRRREEPVSKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.19
4 0.2
5 0.2
6 0.16
7 0.15
8 0.17
9 0.18
10 0.15
11 0.16
12 0.14
13 0.13
14 0.12
15 0.11
16 0.1
17 0.1
18 0.1
19 0.09
20 0.09
21 0.14
22 0.16
23 0.19
24 0.18
25 0.2
26 0.25
27 0.27
28 0.31
29 0.29
30 0.32
31 0.35
32 0.4
33 0.42
34 0.41
35 0.41
36 0.39
37 0.36
38 0.31
39 0.26
40 0.21
41 0.16
42 0.14
43 0.14
44 0.13
45 0.13
46 0.12
47 0.12
48 0.12
49 0.12
50 0.13
51 0.11
52 0.13
53 0.14
54 0.18
55 0.23
56 0.24
57 0.24
58 0.24
59 0.29
60 0.33
61 0.37
62 0.34
63 0.3
64 0.3
65 0.35
66 0.42
67 0.47
68 0.5
69 0.54
70 0.63
71 0.7
72 0.72
73 0.71
74 0.68
75 0.67
76 0.68
77 0.67
78 0.64
79 0.65
80 0.62
81 0.63
82 0.62
83 0.59
84 0.58
85 0.58
86 0.53
87 0.48
88 0.51
89 0.47
90 0.43
91 0.39
92 0.33
93 0.28
94 0.25
95 0.23
96 0.19
97 0.19
98 0.18
99 0.14
100 0.12
101 0.09
102 0.12
103 0.13
104 0.14
105 0.14
106 0.14
107 0.15
108 0.18
109 0.22
110 0.26
111 0.27
112 0.31
113 0.38
114 0.42
115 0.49
116 0.54
117 0.58
118 0.59
119 0.63
120 0.68
121 0.73
122 0.8
123 0.83
124 0.83
125 0.84
126 0.86
127 0.83
128 0.79
129 0.79
130 0.75
131 0.65
132 0.57
133 0.49
134 0.39
135 0.34
136 0.27
137 0.18
138 0.13
139 0.19
140 0.23
141 0.29
142 0.33
143 0.36
144 0.44
145 0.52
146 0.6