Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4QZ29

Protein Details
Accession C4QZ29    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
2-47AKLVHNVQKKQHRERAQPSERRKLGLLEKKKDYKLRAKDRHAKEAYBasic
NLS Segment(s)
PositionSequence
10-56KKQHRERAQPSERRKLGLLEKKKDYKLRAKDRHAKEAYLKLLREKAK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG ppa:PAS_chr1-4_0642  -  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences MAKLVHNVQKKQHRERAQPSERRKLGLLEKKKDYKLRAKDRHAKEAYLKLLREKAKNRNPDEYYHAMVNRTTNEDGIMLEKEEEPALTEEEIYLVKTQNATYVSAMRNRDLGKIRRMKQALSYGSEGKHTVFVDNETELETFDPVKFFKTDARLLNQRENRLKVDQLLDGDLKNYDQVFEKTKLDTDAEKLKQLKLLKSHMDRAKKLQELHNEIVISKELTKEGEKEKLIGSDGKPYYKWKTQRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.87
4 0.88
5 0.88
6 0.87
7 0.88
8 0.8
9 0.73
10 0.64
11 0.6
12 0.6
13 0.6
14 0.61
15 0.59
16 0.65
17 0.7
18 0.75
19 0.75
20 0.73
21 0.73
22 0.74
23 0.76
24 0.77
25 0.8
26 0.84
27 0.84
28 0.86
29 0.79
30 0.72
31 0.67
32 0.64
33 0.61
34 0.57
35 0.51
36 0.45
37 0.49
38 0.51
39 0.53
40 0.53
41 0.56
42 0.59
43 0.67
44 0.68
45 0.7
46 0.67
47 0.62
48 0.62
49 0.55
50 0.49
51 0.43
52 0.39
53 0.31
54 0.29
55 0.28
56 0.22
57 0.22
58 0.2
59 0.17
60 0.16
61 0.15
62 0.14
63 0.14
64 0.13
65 0.09
66 0.09
67 0.09
68 0.09
69 0.09
70 0.08
71 0.08
72 0.08
73 0.09
74 0.08
75 0.08
76 0.07
77 0.08
78 0.08
79 0.07
80 0.07
81 0.06
82 0.07
83 0.08
84 0.08
85 0.1
86 0.11
87 0.12
88 0.12
89 0.15
90 0.17
91 0.21
92 0.22
93 0.19
94 0.21
95 0.21
96 0.25
97 0.28
98 0.3
99 0.34
100 0.42
101 0.45
102 0.49
103 0.5
104 0.45
105 0.44
106 0.47
107 0.4
108 0.35
109 0.33
110 0.27
111 0.27
112 0.27
113 0.22
114 0.15
115 0.16
116 0.13
117 0.11
118 0.1
119 0.1
120 0.11
121 0.11
122 0.1
123 0.09
124 0.09
125 0.08
126 0.08
127 0.07
128 0.07
129 0.07
130 0.07
131 0.06
132 0.08
133 0.08
134 0.09
135 0.12
136 0.16
137 0.21
138 0.23
139 0.29
140 0.34
141 0.37
142 0.46
143 0.46
144 0.49
145 0.49
146 0.5
147 0.48
148 0.43
149 0.41
150 0.35
151 0.33
152 0.28
153 0.23
154 0.22
155 0.2
156 0.17
157 0.16
158 0.14
159 0.11
160 0.11
161 0.1
162 0.08
163 0.1
164 0.12
165 0.17
166 0.2
167 0.21
168 0.21
169 0.22
170 0.24
171 0.23
172 0.22
173 0.21
174 0.27
175 0.27
176 0.33
177 0.33
178 0.32
179 0.35
180 0.38
181 0.39
182 0.36
183 0.41
184 0.44
185 0.47
186 0.56
187 0.58
188 0.62
189 0.6
190 0.61
191 0.63
192 0.6
193 0.59
194 0.57
195 0.59
196 0.59
197 0.59
198 0.56
199 0.47
200 0.42
201 0.39
202 0.33
203 0.25
204 0.18
205 0.16
206 0.13
207 0.16
208 0.18
209 0.21
210 0.25
211 0.31
212 0.31
213 0.31
214 0.32
215 0.32
216 0.32
217 0.32
218 0.29
219 0.31
220 0.33
221 0.35
222 0.35
223 0.39
224 0.44
225 0.48
226 0.56