Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2SSH2

Protein Details
Accession A0A5C2SSH2    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
99-127APFKGEKKEKSEKKPKEKAAKKTEKKEETBasic
182-205TEAPKEEKKEEKKDEKKAKVGRRLBasic
NLS Segment(s)
PositionSequence
82-124AKKEDRPKSPSLLAKLLAPFKGEKKEKSEKKPKEKAAKKTEKK
186-218KEEKKEEKKDEKKAKVGRRLSARVGDFFKPKHK
Subcellular Location(s) nucl 10, cyto_nucl 9.5, mito 9, cyto 7
Family & Domain DBs
Amino Acid Sequences MSETAAPVAPVEETKPVETVAPEAAPAAEPAAEAPATEAPTEEAKVEAAPAAATEAPAAEEAPKTEEAPAATEEAKPAEPEAKKEDRPKSPSLLAKLLAPFKGEKKEKSEKKPKEKAAKKTEKKEETAAPAAEEAPKEPAAETPAEAPKTEEAPAEPVKETETAAAPEAPAAEASAEPAAETEAPKEEKKEEKKDEKKAKVGRRLSARVGDFFKPKHKAEHNTPPKVEENPPKIEEPTPVAPLENPAAEAEPTPAATLPEEPKVEAPPAAPVVAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.18
4 0.19
5 0.18
6 0.19
7 0.16
8 0.14
9 0.13
10 0.12
11 0.12
12 0.11
13 0.11
14 0.09
15 0.07
16 0.06
17 0.07
18 0.08
19 0.08
20 0.07
21 0.09
22 0.11
23 0.12
24 0.12
25 0.12
26 0.11
27 0.14
28 0.14
29 0.13
30 0.11
31 0.1
32 0.1
33 0.1
34 0.09
35 0.07
36 0.06
37 0.06
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.06
47 0.07
48 0.07
49 0.11
50 0.11
51 0.12
52 0.12
53 0.14
54 0.13
55 0.14
56 0.15
57 0.14
58 0.14
59 0.13
60 0.13
61 0.13
62 0.13
63 0.11
64 0.11
65 0.16
66 0.16
67 0.19
68 0.26
69 0.3
70 0.35
71 0.44
72 0.51
73 0.52
74 0.57
75 0.57
76 0.55
77 0.55
78 0.55
79 0.51
80 0.46
81 0.38
82 0.35
83 0.35
84 0.32
85 0.26
86 0.23
87 0.2
88 0.2
89 0.29
90 0.3
91 0.29
92 0.35
93 0.45
94 0.52
95 0.61
96 0.69
97 0.7
98 0.77
99 0.83
100 0.84
101 0.85
102 0.85
103 0.84
104 0.85
105 0.86
106 0.83
107 0.83
108 0.84
109 0.78
110 0.72
111 0.66
112 0.58
113 0.52
114 0.47
115 0.38
116 0.28
117 0.24
118 0.22
119 0.19
120 0.15
121 0.1
122 0.09
123 0.09
124 0.08
125 0.08
126 0.08
127 0.09
128 0.09
129 0.09
130 0.1
131 0.13
132 0.13
133 0.13
134 0.13
135 0.13
136 0.14
137 0.14
138 0.11
139 0.09
140 0.13
141 0.14
142 0.15
143 0.14
144 0.13
145 0.14
146 0.14
147 0.14
148 0.1
149 0.1
150 0.09
151 0.09
152 0.09
153 0.08
154 0.08
155 0.07
156 0.06
157 0.05
158 0.05
159 0.04
160 0.04
161 0.05
162 0.05
163 0.05
164 0.04
165 0.04
166 0.05
167 0.05
168 0.06
169 0.06
170 0.09
171 0.12
172 0.13
173 0.15
174 0.19
175 0.27
176 0.35
177 0.44
178 0.5
179 0.59
180 0.67
181 0.76
182 0.82
183 0.8
184 0.81
185 0.81
186 0.81
187 0.8
188 0.77
189 0.73
190 0.71
191 0.69
192 0.64
193 0.62
194 0.54
195 0.49
196 0.47
197 0.44
198 0.4
199 0.38
200 0.42
201 0.41
202 0.41
203 0.45
204 0.49
205 0.53
206 0.58
207 0.66
208 0.69
209 0.71
210 0.7
211 0.66
212 0.61
213 0.57
214 0.56
215 0.55
216 0.51
217 0.49
218 0.51
219 0.49
220 0.48
221 0.45
222 0.4
223 0.36
224 0.34
225 0.3
226 0.28
227 0.26
228 0.24
229 0.25
230 0.25
231 0.19
232 0.16
233 0.14
234 0.15
235 0.14
236 0.15
237 0.14
238 0.12
239 0.12
240 0.12
241 0.12
242 0.11
243 0.12
244 0.16
245 0.17
246 0.22
247 0.23
248 0.24
249 0.25
250 0.27
251 0.28
252 0.24
253 0.22
254 0.21
255 0.22
256 0.2
257 0.18