Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SK78

Protein Details
Accession A0A5C2SK78   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
28-60DEPSRTKSKGKGKAIDRNKKDKGKAKAKEQPYABasic
NLS Segment(s)
PositionSequence
32-55RTKSKGKGKAIDRNKKDKGKAKAK
Subcellular Location(s) cyto 3, cyto_mito 3, mito 3, nucl 18
Family & Domain DBs
InterPro View protein in InterPro  
IPR046349  C1-like_sf  
IPR007198  Ssl1-like  
IPR004595  TFIIH_C1-like_dom  
IPR012170  TFIIH_SSL1/p44  
IPR002035  VWF_A  
IPR036465  vWFA_dom_sf  
IPR013087  Znf_C2H2_type  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000439  C:transcription factor TFIIH core complex  
GO:0005675  C:transcription factor TFIIH holo complex  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
GO:0006289  P:nucleotide-excision repair  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF07975  C1_4  
PF04056  Ssl1  
PROSITE View protein in PROSITE  
PS50234  VWFA  
PS00028  ZINC_FINGER_C2H2_1  
CDD cd01453  vWA_transcription_factor_IIH_type  
Amino Acid Sequences MAPPAGRRIGDDFVDDSDSDVSITGLEDEPSRTKSKGKGKAIDRNKKDKGKAKAKEQPYAWEASYTRSWETVQEDEAGRLEGAVQDLIARGRRRRLLAPAAAIRRTIIRHLVLVLDLSSAMMDRDMRPTRFDLMLQYAREFVTEWFDQNPLGQIGVVGMRGGLGERIGEMSGNPQDVLKAISERHKLEPNGEPSLQNAIEMARSSMSHLPTHSSREITIIFGSLTTCDPGNIHDTLDECLKDRIRISIVALAAEMKICRDLCEKTGGQFGVAMNEGHFKDLLFELIPPPAQRAVARAGGPGANPAADLMIMGFPMRLPDTSPPSLCVCHSQMKSEGFLCPRCLAKVCDVPTDCDICGLMIVSSPHLARSYHHLFPVKPYAAVMSLEDTPDPSKRCHGCSVAFRDTPSTMFGAAGEGMSPLGRYRCPECHNDFCTDCDVFVHDVVHCCPGCGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.2
4 0.17
5 0.16
6 0.13
7 0.12
8 0.09
9 0.07
10 0.08
11 0.08
12 0.08
13 0.09
14 0.1
15 0.13
16 0.17
17 0.21
18 0.24
19 0.23
20 0.28
21 0.36
22 0.45
23 0.52
24 0.58
25 0.63
26 0.69
27 0.78
28 0.84
29 0.86
30 0.85
31 0.85
32 0.85
33 0.85
34 0.85
35 0.83
36 0.83
37 0.83
38 0.82
39 0.82
40 0.82
41 0.8
42 0.79
43 0.72
44 0.69
45 0.61
46 0.57
47 0.47
48 0.42
49 0.36
50 0.33
51 0.34
52 0.3
53 0.28
54 0.25
55 0.25
56 0.23
57 0.27
58 0.25
59 0.22
60 0.23
61 0.23
62 0.22
63 0.22
64 0.2
65 0.15
66 0.12
67 0.11
68 0.09
69 0.09
70 0.08
71 0.07
72 0.06
73 0.07
74 0.1
75 0.15
76 0.19
77 0.22
78 0.29
79 0.34
80 0.38
81 0.41
82 0.47
83 0.5
84 0.5
85 0.53
86 0.54
87 0.53
88 0.5
89 0.46
90 0.39
91 0.33
92 0.3
93 0.26
94 0.23
95 0.19
96 0.19
97 0.19
98 0.19
99 0.17
100 0.16
101 0.13
102 0.08
103 0.07
104 0.06
105 0.05
106 0.05
107 0.04
108 0.05
109 0.06
110 0.07
111 0.15
112 0.2
113 0.21
114 0.24
115 0.26
116 0.29
117 0.28
118 0.28
119 0.23
120 0.25
121 0.29
122 0.28
123 0.26
124 0.24
125 0.23
126 0.22
127 0.2
128 0.13
129 0.14
130 0.13
131 0.14
132 0.14
133 0.14
134 0.14
135 0.14
136 0.15
137 0.1
138 0.09
139 0.08
140 0.06
141 0.07
142 0.07
143 0.07
144 0.05
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.03
151 0.03
152 0.03
153 0.04
154 0.04
155 0.04
156 0.04
157 0.07
158 0.09
159 0.09
160 0.09
161 0.08
162 0.08
163 0.09
164 0.1
165 0.07
166 0.08
167 0.09
168 0.16
169 0.2
170 0.23
171 0.26
172 0.31
173 0.3
174 0.33
175 0.38
176 0.35
177 0.36
178 0.34
179 0.3
180 0.26
181 0.29
182 0.25
183 0.18
184 0.14
185 0.1
186 0.1
187 0.1
188 0.09
189 0.05
190 0.06
191 0.08
192 0.11
193 0.13
194 0.13
195 0.13
196 0.16
197 0.17
198 0.22
199 0.21
200 0.18
201 0.17
202 0.18
203 0.18
204 0.15
205 0.14
206 0.1
207 0.08
208 0.08
209 0.07
210 0.06
211 0.06
212 0.06
213 0.05
214 0.05
215 0.05
216 0.06
217 0.09
218 0.09
219 0.09
220 0.09
221 0.1
222 0.1
223 0.12
224 0.11
225 0.09
226 0.12
227 0.12
228 0.13
229 0.12
230 0.13
231 0.13
232 0.14
233 0.14
234 0.15
235 0.14
236 0.13
237 0.13
238 0.11
239 0.09
240 0.09
241 0.08
242 0.04
243 0.07
244 0.07
245 0.08
246 0.11
247 0.12
248 0.13
249 0.19
250 0.19
251 0.18
252 0.23
253 0.21
254 0.19
255 0.19
256 0.17
257 0.13
258 0.14
259 0.12
260 0.08
261 0.12
262 0.12
263 0.11
264 0.11
265 0.09
266 0.1
267 0.1
268 0.1
269 0.07
270 0.07
271 0.08
272 0.09
273 0.1
274 0.08
275 0.1
276 0.1
277 0.11
278 0.1
279 0.12
280 0.14
281 0.17
282 0.18
283 0.16
284 0.17
285 0.16
286 0.16
287 0.15
288 0.12
289 0.08
290 0.07
291 0.07
292 0.06
293 0.05
294 0.04
295 0.04
296 0.04
297 0.04
298 0.04
299 0.04
300 0.04
301 0.05
302 0.06
303 0.06
304 0.08
305 0.12
306 0.19
307 0.22
308 0.23
309 0.24
310 0.25
311 0.27
312 0.25
313 0.26
314 0.23
315 0.28
316 0.28
317 0.29
318 0.33
319 0.33
320 0.35
321 0.31
322 0.32
323 0.28
324 0.3
325 0.29
326 0.26
327 0.26
328 0.25
329 0.27
330 0.25
331 0.27
332 0.32
333 0.32
334 0.38
335 0.37
336 0.39
337 0.39
338 0.39
339 0.32
340 0.25
341 0.23
342 0.15
343 0.14
344 0.11
345 0.08
346 0.07
347 0.07
348 0.08
349 0.1
350 0.1
351 0.11
352 0.12
353 0.12
354 0.12
355 0.2
356 0.25
357 0.26
358 0.32
359 0.35
360 0.34
361 0.4
362 0.48
363 0.41
364 0.35
365 0.32
366 0.28
367 0.26
368 0.26
369 0.21
370 0.14
371 0.14
372 0.14
373 0.14
374 0.14
375 0.15
376 0.19
377 0.2
378 0.2
379 0.28
380 0.31
381 0.36
382 0.4
383 0.43
384 0.45
385 0.52
386 0.59
387 0.58
388 0.55
389 0.52
390 0.49
391 0.45
392 0.4
393 0.32
394 0.25
395 0.17
396 0.16
397 0.15
398 0.13
399 0.12
400 0.1
401 0.08
402 0.07
403 0.07
404 0.07
405 0.07
406 0.08
407 0.1
408 0.12
409 0.16
410 0.22
411 0.3
412 0.35
413 0.43
414 0.49
415 0.56
416 0.58
417 0.61
418 0.56
419 0.5
420 0.51
421 0.43
422 0.35
423 0.26
424 0.26
425 0.21
426 0.21
427 0.2
428 0.17
429 0.19
430 0.21
431 0.27
432 0.23