Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2SLQ0

Protein Details
Accession A0A5C2SLQ0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-26ASPGSPSSRYKRPRRTIVYPHHMLHydrophilic
59-83HSPAKPLTPHSRRGRRRPQPLFMSVHydrophilic
NLS Segment(s)
PositionSequence
69-75SRRGRRR
Subcellular Location(s) mito 14, nucl 9.5, cyto_nucl 6.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSASPGSPSSRYKRPRRTIVYPHHMLTYLYHPTRPPDPLVVCHDGRGLLFGLSPSLPPHSPAKPLTPHSRRGRRRPQPLFMSVAWLPVFGHRLRERLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.8
3 0.82
4 0.85
5 0.85
6 0.86
7 0.85
8 0.78
9 0.7
10 0.6
11 0.52
12 0.43
13 0.35
14 0.29
15 0.27
16 0.24
17 0.24
18 0.23
19 0.26
20 0.28
21 0.28
22 0.25
23 0.23
24 0.23
25 0.26
26 0.3
27 0.32
28 0.29
29 0.27
30 0.26
31 0.2
32 0.19
33 0.16
34 0.11
35 0.06
36 0.06
37 0.05
38 0.06
39 0.05
40 0.06
41 0.05
42 0.08
43 0.08
44 0.1
45 0.14
46 0.15
47 0.19
48 0.21
49 0.25
50 0.28
51 0.33
52 0.42
53 0.42
54 0.5
55 0.57
56 0.66
57 0.7
58 0.75
59 0.81
60 0.81
61 0.88
62 0.86
63 0.85
64 0.82
65 0.77
66 0.71
67 0.6
68 0.56
69 0.45
70 0.41
71 0.31
72 0.24
73 0.21
74 0.18
75 0.22
76 0.16
77 0.25
78 0.24