Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2SKN8

Protein Details
Accession A0A5C2SKN8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-58PAKPLTPHSRRGRRRPQPLFMSHydrophilic
NLS Segment(s)
PositionSequence
45-51SRRGRRR
Subcellular Location(s) nucl 12, mito 9, cyto 3, plas 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MLTYLYHPTRPPDPLVVCHDGRGLLFGLSPSLPPHSPAKPLTPHSRRGRRRPQPLFMSVAWLPVFGHRLRERLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.42
4 0.38
5 0.36
6 0.33
7 0.26
8 0.23
9 0.2
10 0.14
11 0.08
12 0.08
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.09
19 0.09
20 0.11
21 0.15
22 0.15
23 0.18
24 0.2
25 0.23
26 0.25
27 0.3
28 0.38
29 0.38
30 0.46
31 0.53
32 0.62
33 0.66
34 0.72
35 0.79
36 0.79
37 0.86
38 0.84
39 0.83
40 0.8
41 0.75
42 0.69
43 0.58
44 0.54
45 0.43
46 0.39
47 0.3
48 0.23
49 0.2
50 0.17
51 0.21
52 0.15
53 0.24
54 0.23