Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SP01

Protein Details
Accession A0A5C2SP01   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-49KPEPAPKKAPAKPRTKKVKEPAAEBasic
NLS Segment(s)
PositionSequence
16-63RRSARIKDQPKPEPAPKKAPAKPRTKKVKEPAAEGEEKPKSTKGRKRT
83-164PAKKAKPASKAAGKPASKAAGAKPASKASRAGSAKPASRAASAKPASRASAKPPSTTKKPASRTGSKKPASKVRGVRWSAAK
Subcellular Location(s) cyto 3.5, cyto_nucl 12.5, nucl 20.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000079  HMGN_fam  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0031492  F:nucleosomal DNA binding  
Amino Acid Sequences MPRKAATTTETNAEPRRSARIKDQPKPEPAPKKAPAKPRTKKVKEPAAEGEEKPKSTKGRKRTAAEKDDEELDGAAVNGDEPPAKKAKPASKAAGKPASKAAGAKPASKASRAGSAKPASRAASAKPASRASAKPPSTTKKPASRTGSKKPASKVRGVRWSAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.4
4 0.4
5 0.4
6 0.45
7 0.51
8 0.58
9 0.64
10 0.72
11 0.7
12 0.74
13 0.79
14 0.78
15 0.77
16 0.73
17 0.74
18 0.72
19 0.74
20 0.72
21 0.75
22 0.74
23 0.75
24 0.78
25 0.79
26 0.83
27 0.81
28 0.84
29 0.83
30 0.84
31 0.76
32 0.72
33 0.69
34 0.64
35 0.6
36 0.51
37 0.49
38 0.41
39 0.39
40 0.35
41 0.32
42 0.32
43 0.38
44 0.45
45 0.47
46 0.54
47 0.62
48 0.66
49 0.71
50 0.74
51 0.71
52 0.67
53 0.6
54 0.51
55 0.44
56 0.39
57 0.3
58 0.2
59 0.13
60 0.09
61 0.06
62 0.05
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.06
70 0.08
71 0.09
72 0.1
73 0.17
74 0.23
75 0.29
76 0.34
77 0.38
78 0.44
79 0.47
80 0.51
81 0.54
82 0.48
83 0.42
84 0.41
85 0.36
86 0.29
87 0.27
88 0.22
89 0.22
90 0.24
91 0.24
92 0.24
93 0.28
94 0.29
95 0.29
96 0.3
97 0.23
98 0.3
99 0.3
100 0.3
101 0.31
102 0.35
103 0.37
104 0.37
105 0.39
106 0.31
107 0.32
108 0.32
109 0.27
110 0.31
111 0.31
112 0.32
113 0.33
114 0.33
115 0.33
116 0.36
117 0.36
118 0.33
119 0.41
120 0.4
121 0.41
122 0.47
123 0.52
124 0.55
125 0.61
126 0.63
127 0.62
128 0.66
129 0.7
130 0.72
131 0.74
132 0.75
133 0.77
134 0.79
135 0.76
136 0.77
137 0.75
138 0.77
139 0.72
140 0.73
141 0.72
142 0.71
143 0.75
144 0.72