Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2S8C7

Protein Details
Accession A0A5C2S8C7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-76EQQLARDERRRPRWKKPEKKEYRLLPKISKPPARKRAKQAEDNEDBasic
NLS Segment(s)
PositionSequence
39-69ERRRPRWKKPEKKEYRLLPKISKPPARKRAK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MEEWKRQEAERKKKNTAITAHFEAAVEEWRAEQQLARDERRRPRWKKPEKKEYRLLPKISKPPARKRAKQAEDNEDEEEVSSSAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.72
3 0.69
4 0.64
5 0.62
6 0.58
7 0.52
8 0.46
9 0.4
10 0.32
11 0.25
12 0.21
13 0.14
14 0.09
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.09
21 0.16
22 0.2
23 0.24
24 0.29
25 0.35
26 0.44
27 0.54
28 0.62
29 0.61
30 0.67
31 0.74
32 0.8
33 0.85
34 0.87
35 0.88
36 0.88
37 0.89
38 0.87
39 0.86
40 0.85
41 0.82
42 0.77
43 0.72
44 0.69
45 0.7
46 0.69
47 0.69
48 0.66
49 0.7
50 0.75
51 0.78
52 0.78
53 0.8
54 0.83
55 0.83
56 0.83
57 0.81
58 0.8
59 0.76
60 0.71
61 0.63
62 0.52
63 0.43
64 0.35
65 0.28
66 0.18