Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2RVB9

Protein Details
Accession A0A5C2RVB9   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-30AANFKWAEERKRKREEYRASDAAHydrophilic
NLS Segment(s)
PositionSequence
17-22RKRKRE
72-73PK
Subcellular Location(s) cyto_nucl 11, mito 6, nucl 19.5
Family & Domain DBs
Amino Acid Sequences MTYHGRGAANFKWAEERKRKREEYRASDAAKKTRVDERVGERVVSKAAGGSGSQSTSLSKTAGPSGPFKSKPKPKTSKGTEAMNDDRDAKGETEKEEFQLIDYETVGEEVGMSKAEGKQHAGSKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.58
4 0.61
5 0.71
6 0.79
7 0.78
8 0.84
9 0.85
10 0.82
11 0.81
12 0.78
13 0.72
14 0.71
15 0.66
16 0.62
17 0.56
18 0.49
19 0.43
20 0.42
21 0.42
22 0.38
23 0.39
24 0.4
25 0.43
26 0.42
27 0.4
28 0.33
29 0.31
30 0.28
31 0.22
32 0.15
33 0.07
34 0.07
35 0.07
36 0.06
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.08
43 0.08
44 0.09
45 0.08
46 0.08
47 0.08
48 0.1
49 0.12
50 0.13
51 0.15
52 0.18
53 0.23
54 0.26
55 0.29
56 0.36
57 0.43
58 0.49
59 0.56
60 0.61
61 0.62
62 0.7
63 0.73
64 0.74
65 0.7
66 0.69
67 0.61
68 0.59
69 0.56
70 0.48
71 0.41
72 0.33
73 0.28
74 0.23
75 0.22
76 0.16
77 0.16
78 0.15
79 0.16
80 0.19
81 0.2
82 0.2
83 0.2
84 0.19
85 0.17
86 0.18
87 0.17
88 0.13
89 0.13
90 0.12
91 0.1
92 0.11
93 0.1
94 0.06
95 0.05
96 0.05
97 0.06
98 0.06
99 0.06
100 0.08
101 0.1
102 0.15
103 0.16
104 0.2
105 0.25
106 0.32