Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2RLM9

Protein Details
Accession A0A5C2RLM9   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
89-110CRDSRAPLKKGKKRPLPGNGSWHydrophilic
NLS Segment(s)
PositionSequence
95-103PLKKGKKRP
Subcellular Location(s) cyto 2.5, cyto_mito 10, mito 16.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR041457  CxC2_KDZ-assoc  
Pfam View protein in Pfam  
PF18803  CxC2  
Amino Acid Sequences RMRCFDCFRQPHLCMPCASLAHQLSPFHRLLEWEMQAGFWKKLTRADLRIRLHYGHNGQPCPRRRSAFREVLVVHDRGMTKIPVALCSCRDSRAPLKKGKKRPLPGNGSWPGSWDTPRTVYTVDVLRQYHLLTLQAHTTVHDFHAYLRRTTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.42
4 0.35
5 0.34
6 0.33
7 0.28
8 0.28
9 0.31
10 0.31
11 0.27
12 0.31
13 0.29
14 0.22
15 0.22
16 0.2
17 0.21
18 0.26
19 0.25
20 0.21
21 0.21
22 0.2
23 0.24
24 0.25
25 0.21
26 0.17
27 0.18
28 0.17
29 0.22
30 0.28
31 0.29
32 0.34
33 0.42
34 0.48
35 0.5
36 0.53
37 0.51
38 0.47
39 0.43
40 0.42
41 0.37
42 0.34
43 0.35
44 0.33
45 0.35
46 0.41
47 0.47
48 0.48
49 0.48
50 0.46
51 0.45
52 0.51
53 0.55
54 0.55
55 0.49
56 0.48
57 0.44
58 0.45
59 0.43
60 0.35
61 0.27
62 0.2
63 0.19
64 0.15
65 0.16
66 0.11
67 0.08
68 0.1
69 0.1
70 0.11
71 0.12
72 0.13
73 0.13
74 0.17
75 0.17
76 0.17
77 0.17
78 0.2
79 0.27
80 0.36
81 0.4
82 0.46
83 0.56
84 0.64
85 0.73
86 0.79
87 0.79
88 0.78
89 0.82
90 0.82
91 0.8
92 0.75
93 0.74
94 0.68
95 0.62
96 0.53
97 0.46
98 0.39
99 0.32
100 0.3
101 0.22
102 0.21
103 0.2
104 0.21
105 0.21
106 0.19
107 0.18
108 0.19
109 0.22
110 0.21
111 0.23
112 0.23
113 0.23
114 0.23
115 0.22
116 0.21
117 0.17
118 0.18
119 0.15
120 0.16
121 0.16
122 0.17
123 0.16
124 0.16
125 0.17
126 0.15
127 0.15
128 0.16
129 0.14
130 0.17
131 0.26
132 0.27