Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4QYZ5

Protein Details
Accession C4QYZ5   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-30NELVRRYKREGHFDKKRKELBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
KEGG ppa:PAS_chr1-4_0610  -  
Pfam View protein in Pfam  
PF05205  COMPASS-Shg1  
Amino Acid Sequences MDQKELSLDANELVRRYKREGHFDKKRKELLDQFKLSPEYKQLLESLKSDVESRVKQDPLVLLDSSKRAQAVALAEGTATRSGASTLANYARTTTIESQTLNAAIKEQMEEFLKSNETKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.31
4 0.38
5 0.4
6 0.5
7 0.58
8 0.63
9 0.71
10 0.77
11 0.8
12 0.79
13 0.79
14 0.71
15 0.69
16 0.68
17 0.67
18 0.67
19 0.63
20 0.55
21 0.53
22 0.55
23 0.47
24 0.39
25 0.32
26 0.25
27 0.22
28 0.21
29 0.19
30 0.19
31 0.2
32 0.2
33 0.19
34 0.16
35 0.16
36 0.16
37 0.16
38 0.17
39 0.16
40 0.18
41 0.2
42 0.2
43 0.2
44 0.2
45 0.19
46 0.16
47 0.18
48 0.14
49 0.11
50 0.11
51 0.13
52 0.13
53 0.12
54 0.1
55 0.08
56 0.08
57 0.09
58 0.1
59 0.09
60 0.09
61 0.08
62 0.08
63 0.08
64 0.09
65 0.07
66 0.06
67 0.04
68 0.04
69 0.05
70 0.06
71 0.06
72 0.06
73 0.09
74 0.11
75 0.13
76 0.13
77 0.14
78 0.14
79 0.14
80 0.18
81 0.19
82 0.2
83 0.21
84 0.21
85 0.21
86 0.21
87 0.23
88 0.19
89 0.16
90 0.14
91 0.13
92 0.13
93 0.13
94 0.12
95 0.14
96 0.15
97 0.17
98 0.18
99 0.19
100 0.22