Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2STX3

Protein Details
Accession A0A5C2STX3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-32ASMARERSWSPGRRRPPRARSPPASRTWPHydrophilic
NLS Segment(s)
PositionSequence
12-26WSPGRRRPPRARSPP
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSRASMARERSWSPGRRRPPRARSPPASRTWPCLRELPRRLSASHRPHAASSRGSPHNPSPDHHQIPDSSVPRPVASSGGRTPCSCPPTCARAARQRISKSTCSLYIVLTKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.67
3 0.72
4 0.81
5 0.84
6 0.85
7 0.88
8 0.89
9 0.9
10 0.88
11 0.87
12 0.85
13 0.8
14 0.79
15 0.69
16 0.66
17 0.64
18 0.58
19 0.51
20 0.5
21 0.5
22 0.51
23 0.56
24 0.55
25 0.54
26 0.53
27 0.52
28 0.52
29 0.55
30 0.53
31 0.52
32 0.48
33 0.42
34 0.42
35 0.44
36 0.4
37 0.32
38 0.26
39 0.28
40 0.28
41 0.28
42 0.29
43 0.28
44 0.33
45 0.31
46 0.31
47 0.32
48 0.38
49 0.39
50 0.37
51 0.35
52 0.28
53 0.31
54 0.36
55 0.29
56 0.22
57 0.22
58 0.22
59 0.21
60 0.21
61 0.18
62 0.15
63 0.15
64 0.18
65 0.21
66 0.25
67 0.27
68 0.27
69 0.3
70 0.33
71 0.38
72 0.34
73 0.33
74 0.33
75 0.38
76 0.43
77 0.46
78 0.47
79 0.52
80 0.59
81 0.63
82 0.67
83 0.66
84 0.68
85 0.69
86 0.66
87 0.61
88 0.57
89 0.52
90 0.47
91 0.42
92 0.36