Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SF89

Protein Details
Accession A0A5C2SF89   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
266-285ASETSKPQNRKRDRGMKMGVHydrophilic
NLS Segment(s)
PositionSequence
206-240AAGKVKLGKGEATVRKSEHNRAAKHVRDGLFEKRK
309-328SSRGRGRGRGGRARGRGGKR
Subcellular Location(s) cyto_nucl 11.833, mito 4.5, mito_nucl 12.833, nucl 20
Family & Domain DBs
Amino Acid Sequences MSPFSGRPVNMSSDDLLKLLEAHGQQFLQAFDTPVVLGKRKDVPAHKSAERDVKKNKVDEDLEEEEWEGIQSDPDSDVEDESEKDESEDATYGEDEDEDDDFTYESHSHKPDIIVFSEASTSSAIPRQSKSGFMSSKVTKLTQDAPKSSQKKTASDDEDDDLTNAQNDALLHRLVHTQLLSGSLNPDLDLTPAQRKKALAGRIMEAAGKVKLGKGEATVRKSEHNRAAKHVRDGLFEKRKERQQKQLEEAKQLGNYHPKLKALFDASETSKPQNRKRDRGMKMGVGSFQGGILKLGKNEISAIESRSSSSRGRGRGRGGRARGRGGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.21
4 0.16
5 0.14
6 0.12
7 0.15
8 0.13
9 0.14
10 0.16
11 0.16
12 0.16
13 0.17
14 0.17
15 0.15
16 0.15
17 0.15
18 0.13
19 0.13
20 0.13
21 0.15
22 0.18
23 0.19
24 0.19
25 0.22
26 0.28
27 0.32
28 0.39
29 0.42
30 0.46
31 0.49
32 0.56
33 0.55
34 0.52
35 0.54
36 0.57
37 0.55
38 0.56
39 0.57
40 0.6
41 0.62
42 0.62
43 0.59
44 0.56
45 0.54
46 0.49
47 0.48
48 0.44
49 0.39
50 0.34
51 0.32
52 0.24
53 0.22
54 0.19
55 0.12
56 0.07
57 0.07
58 0.06
59 0.07
60 0.08
61 0.08
62 0.1
63 0.09
64 0.1
65 0.1
66 0.11
67 0.11
68 0.11
69 0.12
70 0.1
71 0.1
72 0.1
73 0.09
74 0.09
75 0.09
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.07
82 0.06
83 0.07
84 0.07
85 0.06
86 0.07
87 0.06
88 0.06
89 0.06
90 0.08
91 0.08
92 0.09
93 0.13
94 0.14
95 0.15
96 0.16
97 0.17
98 0.2
99 0.21
100 0.21
101 0.18
102 0.17
103 0.16
104 0.16
105 0.15
106 0.12
107 0.1
108 0.08
109 0.08
110 0.11
111 0.13
112 0.14
113 0.15
114 0.19
115 0.19
116 0.22
117 0.24
118 0.28
119 0.27
120 0.27
121 0.32
122 0.29
123 0.31
124 0.3
125 0.28
126 0.21
127 0.22
128 0.27
129 0.28
130 0.3
131 0.3
132 0.32
133 0.41
134 0.44
135 0.43
136 0.44
137 0.4
138 0.4
139 0.41
140 0.45
141 0.39
142 0.38
143 0.38
144 0.32
145 0.3
146 0.26
147 0.22
148 0.14
149 0.1
150 0.08
151 0.06
152 0.05
153 0.05
154 0.05
155 0.05
156 0.06
157 0.07
158 0.06
159 0.07
160 0.08
161 0.08
162 0.09
163 0.08
164 0.07
165 0.07
166 0.09
167 0.09
168 0.08
169 0.08
170 0.08
171 0.08
172 0.08
173 0.08
174 0.06
175 0.06
176 0.07
177 0.08
178 0.16
179 0.19
180 0.19
181 0.21
182 0.21
183 0.24
184 0.3
185 0.33
186 0.29
187 0.29
188 0.3
189 0.29
190 0.29
191 0.25
192 0.2
193 0.16
194 0.11
195 0.1
196 0.08
197 0.08
198 0.08
199 0.09
200 0.09
201 0.1
202 0.19
203 0.24
204 0.27
205 0.29
206 0.3
207 0.35
208 0.39
209 0.44
210 0.44
211 0.46
212 0.45
213 0.5
214 0.58
215 0.55
216 0.56
217 0.55
218 0.48
219 0.44
220 0.46
221 0.48
222 0.49
223 0.48
224 0.48
225 0.48
226 0.56
227 0.62
228 0.65
229 0.65
230 0.66
231 0.71
232 0.75
233 0.77
234 0.73
235 0.68
236 0.65
237 0.57
238 0.49
239 0.42
240 0.38
241 0.38
242 0.36
243 0.35
244 0.35
245 0.35
246 0.33
247 0.33
248 0.34
249 0.29
250 0.27
251 0.25
252 0.28
253 0.29
254 0.32
255 0.33
256 0.33
257 0.35
258 0.41
259 0.47
260 0.53
261 0.59
262 0.64
263 0.72
264 0.78
265 0.78
266 0.81
267 0.79
268 0.74
269 0.69
270 0.62
271 0.53
272 0.44
273 0.39
274 0.28
275 0.23
276 0.17
277 0.13
278 0.12
279 0.13
280 0.13
281 0.13
282 0.16
283 0.16
284 0.15
285 0.16
286 0.16
287 0.17
288 0.17
289 0.19
290 0.19
291 0.19
292 0.2
293 0.22
294 0.24
295 0.23
296 0.29
297 0.33
298 0.39
299 0.47
300 0.52
301 0.59
302 0.64
303 0.72
304 0.73
305 0.75
306 0.76
307 0.74
308 0.77