Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SB94

Protein Details
Accession A0A5C2SB94   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
99-123QPRTRWESGARRQPRRRPRLCLCCEHydrophilic
NLS Segment(s)
PositionSequence
112-114PRR
Subcellular Location(s) cyto 6, extr 4, mito 3, nucl 13
Family & Domain DBs
Amino Acid Sequences MTDGDARDVLYVRAWGGGVLNIAWCGVRCAREGRWWTCAVIMSWAATRRVGGGKTISSRSHDRQAPSYVRLRDSRDHSERTTGSLGWCEECDAPASTQQPRTRWESGARRQPRRRPRLCLCCELASDLARARASEETRRYQIRLARWADARCARSHLDPLASGQRTMNPSPASVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.09
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.07
12 0.09
13 0.11
14 0.12
15 0.14
16 0.19
17 0.21
18 0.29
19 0.36
20 0.37
21 0.39
22 0.39
23 0.37
24 0.34
25 0.33
26 0.25
27 0.21
28 0.18
29 0.14
30 0.15
31 0.17
32 0.16
33 0.15
34 0.14
35 0.14
36 0.16
37 0.16
38 0.15
39 0.15
40 0.17
41 0.21
42 0.24
43 0.23
44 0.25
45 0.3
46 0.32
47 0.37
48 0.38
49 0.37
50 0.38
51 0.43
52 0.42
53 0.4
54 0.43
55 0.38
56 0.37
57 0.38
58 0.38
59 0.37
60 0.39
61 0.44
62 0.42
63 0.44
64 0.41
65 0.42
66 0.38
67 0.36
68 0.31
69 0.23
70 0.19
71 0.17
72 0.16
73 0.12
74 0.12
75 0.1
76 0.09
77 0.09
78 0.1
79 0.09
80 0.09
81 0.11
82 0.13
83 0.14
84 0.2
85 0.23
86 0.24
87 0.26
88 0.32
89 0.32
90 0.32
91 0.38
92 0.41
93 0.47
94 0.55
95 0.61
96 0.65
97 0.71
98 0.78
99 0.81
100 0.82
101 0.81
102 0.8
103 0.81
104 0.82
105 0.79
106 0.76
107 0.69
108 0.61
109 0.55
110 0.48
111 0.39
112 0.29
113 0.25
114 0.19
115 0.18
116 0.15
117 0.14
118 0.14
119 0.17
120 0.19
121 0.26
122 0.31
123 0.34
124 0.39
125 0.42
126 0.42
127 0.42
128 0.44
129 0.43
130 0.46
131 0.44
132 0.45
133 0.47
134 0.48
135 0.5
136 0.52
137 0.48
138 0.4
139 0.41
140 0.38
141 0.36
142 0.39
143 0.34
144 0.3
145 0.28
146 0.31
147 0.36
148 0.34
149 0.32
150 0.29
151 0.31
152 0.34
153 0.35
154 0.37
155 0.28