Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SE92

Protein Details
Accession A0A5C2SE92   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTPDGRRRPPRDPQRPNSAPQHydrophilic
NLS Segment(s)
PositionSequence
7-11RRPPR
Subcellular Location(s) cyto 5, cyto_nucl 13.5, nucl 20
Family & Domain DBs
Amino Acid Sequences MTPDGRRRPPRDPQRPNSAPQASKRKGFAQEDLRATGRRGSLIFTKTEDVKVTPQAGGKLRAGASSGGPGPRTSASSSSGSGSRAGHGSGSRQKEPQAQVAAELTRNRLEQFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.77
4 0.76
5 0.72
6 0.66
7 0.64
8 0.67
9 0.6
10 0.6
11 0.59
12 0.55
13 0.55
14 0.53
15 0.52
16 0.49
17 0.52
18 0.51
19 0.5
20 0.47
21 0.4
22 0.37
23 0.33
24 0.25
25 0.19
26 0.17
27 0.16
28 0.19
29 0.2
30 0.2
31 0.18
32 0.2
33 0.19
34 0.2
35 0.18
36 0.15
37 0.15
38 0.16
39 0.15
40 0.15
41 0.15
42 0.17
43 0.18
44 0.19
45 0.17
46 0.17
47 0.16
48 0.15
49 0.15
50 0.12
51 0.1
52 0.1
53 0.11
54 0.1
55 0.1
56 0.1
57 0.11
58 0.11
59 0.13
60 0.13
61 0.13
62 0.16
63 0.17
64 0.18
65 0.18
66 0.18
67 0.17
68 0.18
69 0.16
70 0.14
71 0.13
72 0.13
73 0.13
74 0.12
75 0.18
76 0.24
77 0.3
78 0.31
79 0.32
80 0.35
81 0.41
82 0.44
83 0.45
84 0.42
85 0.36
86 0.35
87 0.37
88 0.35
89 0.32
90 0.3
91 0.26
92 0.24
93 0.25