Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SDX9

Protein Details
Accession A0A5C2SDX9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
466-495EITFRRDPTNYRPRVNKKESVKDREQKASGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, cyto_nucl 10, nucl 7, cysk 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003439  ABC_transporter-like_ATP-bd  
IPR017871  ABC_transporter-like_CS  
IPR027417  P-loop_NTPase  
IPR013283  RLI1  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF00005  ABC_tran  
PROSITE View protein in PROSITE  
PS00211  ABC_TRANSPORTER_1  
PS50893  ABC_TRANSPORTER_2  
Amino Acid Sequences PRPGQVLGLVGTNGIGKSTALKILAGKLKPNLGRYDDPPDWQEILKYFRGSELQNYFTKVLEDNLKALIKPQYVDHIPRAIKGAMTVTQMLDGKLERDNKQKMCDDLELNEVLTREVVQLSGGELQRFAIAMSCIQRADVYMFDEPSSYLDIKQRLRAAEVIRELLTPHNYVIAVEHDLSVLDYLSDFVCCLYGKPSMYGVVTMPYSVREGINIFLDGFIPTENLRFREESLTFKMVETAEEIVIDKTRHYSYPSMTKTLGNFKLTVESGSFTDSEIIVMLGENGTGKTTFVKLLAGDMPDEETDKQTLSVSLKPQTISPSFPGTVRMLLIKRIKAAFMHPQFNTDVIKPMNLEPILDQDVKTLSGGELQRVAIVLALGKPNVQVYLIDEPSSFLDSEQRIIASKVIKRFILHAKKTAFVIEHDFIMATYLADRVIVFQGQPAVRATATPPQSLLTGMNKFLASLEITFRRDPTNYRPRVNKKESVKDREQKASGNYFFLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.1
5 0.12
6 0.15
7 0.14
8 0.16
9 0.17
10 0.25
11 0.32
12 0.31
13 0.33
14 0.34
15 0.41
16 0.44
17 0.46
18 0.45
19 0.44
20 0.47
21 0.47
22 0.52
23 0.47
24 0.46
25 0.44
26 0.42
27 0.38
28 0.33
29 0.32
30 0.26
31 0.29
32 0.3
33 0.3
34 0.25
35 0.26
36 0.29
37 0.28
38 0.33
39 0.33
40 0.33
41 0.34
42 0.38
43 0.36
44 0.33
45 0.32
46 0.25
47 0.23
48 0.26
49 0.25
50 0.22
51 0.26
52 0.27
53 0.25
54 0.28
55 0.3
56 0.25
57 0.24
58 0.24
59 0.27
60 0.3
61 0.35
62 0.35
63 0.37
64 0.36
65 0.36
66 0.39
67 0.32
68 0.27
69 0.24
70 0.23
71 0.18
72 0.2
73 0.2
74 0.16
75 0.19
76 0.19
77 0.18
78 0.16
79 0.14
80 0.13
81 0.18
82 0.23
83 0.24
84 0.32
85 0.41
86 0.43
87 0.49
88 0.51
89 0.49
90 0.48
91 0.48
92 0.42
93 0.35
94 0.35
95 0.29
96 0.25
97 0.24
98 0.19
99 0.14
100 0.12
101 0.11
102 0.08
103 0.08
104 0.07
105 0.06
106 0.06
107 0.07
108 0.13
109 0.13
110 0.12
111 0.12
112 0.13
113 0.13
114 0.12
115 0.11
116 0.07
117 0.07
118 0.09
119 0.12
120 0.13
121 0.12
122 0.13
123 0.13
124 0.12
125 0.13
126 0.11
127 0.12
128 0.12
129 0.13
130 0.13
131 0.13
132 0.13
133 0.12
134 0.14
135 0.11
136 0.12
137 0.16
138 0.22
139 0.24
140 0.28
141 0.31
142 0.28
143 0.3
144 0.32
145 0.3
146 0.3
147 0.3
148 0.27
149 0.24
150 0.23
151 0.22
152 0.2
153 0.2
154 0.15
155 0.13
156 0.13
157 0.12
158 0.12
159 0.12
160 0.11
161 0.11
162 0.1
163 0.1
164 0.09
165 0.09
166 0.09
167 0.08
168 0.06
169 0.04
170 0.03
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.05
177 0.05
178 0.06
179 0.07
180 0.1
181 0.11
182 0.12
183 0.12
184 0.13
185 0.13
186 0.13
187 0.11
188 0.1
189 0.09
190 0.09
191 0.08
192 0.07
193 0.08
194 0.08
195 0.08
196 0.07
197 0.08
198 0.08
199 0.09
200 0.09
201 0.08
202 0.07
203 0.08
204 0.07
205 0.06
206 0.05
207 0.05
208 0.05
209 0.08
210 0.09
211 0.1
212 0.12
213 0.12
214 0.14
215 0.18
216 0.19
217 0.2
218 0.23
219 0.23
220 0.22
221 0.21
222 0.22
223 0.17
224 0.16
225 0.13
226 0.1
227 0.09
228 0.08
229 0.09
230 0.07
231 0.09
232 0.08
233 0.07
234 0.09
235 0.1
236 0.1
237 0.12
238 0.14
239 0.15
240 0.25
241 0.26
242 0.26
243 0.27
244 0.28
245 0.27
246 0.33
247 0.33
248 0.25
249 0.24
250 0.21
251 0.23
252 0.22
253 0.2
254 0.13
255 0.11
256 0.1
257 0.1
258 0.1
259 0.08
260 0.08
261 0.07
262 0.07
263 0.06
264 0.05
265 0.04
266 0.04
267 0.04
268 0.03
269 0.03
270 0.03
271 0.03
272 0.04
273 0.04
274 0.04
275 0.05
276 0.06
277 0.07
278 0.07
279 0.08
280 0.07
281 0.09
282 0.11
283 0.1
284 0.09
285 0.09
286 0.09
287 0.09
288 0.1
289 0.09
290 0.08
291 0.08
292 0.08
293 0.09
294 0.08
295 0.1
296 0.11
297 0.14
298 0.16
299 0.2
300 0.21
301 0.21
302 0.22
303 0.25
304 0.24
305 0.23
306 0.22
307 0.23
308 0.22
309 0.22
310 0.24
311 0.2
312 0.19
313 0.17
314 0.19
315 0.15
316 0.21
317 0.25
318 0.23
319 0.25
320 0.25
321 0.25
322 0.22
323 0.26
324 0.29
325 0.3
326 0.35
327 0.32
328 0.34
329 0.33
330 0.34
331 0.32
332 0.23
333 0.22
334 0.17
335 0.18
336 0.17
337 0.17
338 0.21
339 0.19
340 0.18
341 0.14
342 0.17
343 0.21
344 0.2
345 0.19
346 0.15
347 0.15
348 0.15
349 0.15
350 0.12
351 0.07
352 0.13
353 0.13
354 0.13
355 0.14
356 0.14
357 0.14
358 0.13
359 0.13
360 0.08
361 0.07
362 0.07
363 0.07
364 0.08
365 0.08
366 0.08
367 0.09
368 0.09
369 0.09
370 0.09
371 0.07
372 0.1
373 0.17
374 0.17
375 0.17
376 0.17
377 0.18
378 0.19
379 0.2
380 0.16
381 0.1
382 0.15
383 0.15
384 0.16
385 0.16
386 0.15
387 0.15
388 0.16
389 0.19
390 0.19
391 0.23
392 0.27
393 0.3
394 0.31
395 0.31
396 0.36
397 0.43
398 0.48
399 0.47
400 0.49
401 0.48
402 0.49
403 0.49
404 0.46
405 0.36
406 0.28
407 0.31
408 0.25
409 0.23
410 0.21
411 0.2
412 0.17
413 0.17
414 0.15
415 0.08
416 0.07
417 0.07
418 0.06
419 0.07
420 0.07
421 0.07
422 0.09
423 0.1
424 0.09
425 0.11
426 0.17
427 0.17
428 0.19
429 0.18
430 0.18
431 0.17
432 0.18
433 0.19
434 0.21
435 0.24
436 0.23
437 0.23
438 0.22
439 0.22
440 0.23
441 0.23
442 0.22
443 0.22
444 0.23
445 0.24
446 0.23
447 0.23
448 0.22
449 0.2
450 0.15
451 0.13
452 0.19
453 0.22
454 0.26
455 0.27
456 0.28
457 0.3
458 0.31
459 0.35
460 0.4
461 0.45
462 0.49
463 0.56
464 0.65
465 0.72
466 0.8
467 0.83
468 0.81
469 0.8
470 0.84
471 0.86
472 0.85
473 0.85
474 0.83
475 0.83
476 0.83
477 0.76
478 0.71
479 0.68
480 0.68
481 0.6
482 0.54