Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2SBT0

Protein Details
Accession A0A5C2SBT0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-92ISSSAPKQRKSCRPIRPASTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 3, plas 3, extr 3
Family & Domain DBs
Amino Acid Sequences MACGKASSFLSFAVLLSTSWRVRGSDVLVVRAVAVPSQVRVVLPSIMMCCRRYSWYLSEITQTPSRVPGSQFISSSAPKQRKSCRPIRPAST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.11
4 0.15
5 0.13
6 0.15
7 0.16
8 0.15
9 0.16
10 0.18
11 0.18
12 0.2
13 0.2
14 0.2
15 0.2
16 0.19
17 0.18
18 0.16
19 0.14
20 0.08
21 0.08
22 0.06
23 0.07
24 0.07
25 0.07
26 0.06
27 0.07
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.09
34 0.11
35 0.11
36 0.11
37 0.12
38 0.15
39 0.16
40 0.19
41 0.2
42 0.22
43 0.24
44 0.23
45 0.25
46 0.24
47 0.26
48 0.25
49 0.23
50 0.2
51 0.21
52 0.22
53 0.21
54 0.21
55 0.23
56 0.25
57 0.27
58 0.27
59 0.27
60 0.29
61 0.28
62 0.32
63 0.36
64 0.37
65 0.4
66 0.47
67 0.55
68 0.61
69 0.68
70 0.73
71 0.74
72 0.77