Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2STX0

Protein Details
Accession A0A5C2STX0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
262-283TETMQAIKRKTKPKFGNLGSKLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, cyto_mito 10.333, cyto_nucl 7.333, mito 7.5, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029045  ClpP/crotonase-like_dom_sf  
IPR045002  Ech1-like  
IPR001753  Enoyl-CoA_hydra/iso  
IPR014748  Enoyl-CoA_hydra_C  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006635  P:fatty acid beta-oxidation  
Pfam View protein in Pfam  
PF00378  ECH_1  
CDD cd06558  crotonase-like  
Amino Acid Sequences MSASDPYSHLSGQFTKVSCPSPHVALVQLERNPVNAFHEPFWVELGNVFDAISNQPSIRAVVLASALPKLFCAGIDFSALKFSDAADAARKALELQKTIASFQDSISALERCRYPVIAATHGVAYGLSIDIIAACDVRYTASNTVFSIKEVDVGLAADIGTLARTPKITGNQSLVSELAFTGRNFSAAEAEKMGLVSRVVQGGRDEVVAAALETAKLIAEKSPIAVLGTKHLLLHARDHSVKENLQYTVVWNSAMLQTQDMTETMQAIKRKTKPKFGNLGSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.31
4 0.35
5 0.32
6 0.34
7 0.33
8 0.31
9 0.33
10 0.31
11 0.3
12 0.29
13 0.32
14 0.33
15 0.32
16 0.32
17 0.29
18 0.3
19 0.28
20 0.24
21 0.26
22 0.26
23 0.27
24 0.24
25 0.28
26 0.27
27 0.26
28 0.27
29 0.22
30 0.16
31 0.15
32 0.16
33 0.13
34 0.12
35 0.11
36 0.09
37 0.1
38 0.12
39 0.12
40 0.1
41 0.09
42 0.1
43 0.11
44 0.12
45 0.11
46 0.1
47 0.08
48 0.08
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.09
60 0.09
61 0.09
62 0.12
63 0.13
64 0.12
65 0.15
66 0.15
67 0.13
68 0.11
69 0.11
70 0.1
71 0.11
72 0.12
73 0.12
74 0.12
75 0.12
76 0.12
77 0.12
78 0.11
79 0.15
80 0.16
81 0.15
82 0.16
83 0.18
84 0.19
85 0.2
86 0.2
87 0.17
88 0.15
89 0.14
90 0.17
91 0.14
92 0.15
93 0.16
94 0.16
95 0.14
96 0.16
97 0.16
98 0.13
99 0.13
100 0.13
101 0.11
102 0.16
103 0.18
104 0.18
105 0.18
106 0.17
107 0.17
108 0.16
109 0.15
110 0.09
111 0.06
112 0.05
113 0.04
114 0.03
115 0.03
116 0.02
117 0.02
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.04
125 0.05
126 0.07
127 0.09
128 0.1
129 0.11
130 0.11
131 0.14
132 0.13
133 0.13
134 0.13
135 0.11
136 0.11
137 0.1
138 0.1
139 0.08
140 0.08
141 0.07
142 0.05
143 0.05
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.04
151 0.04
152 0.05
153 0.09
154 0.14
155 0.17
156 0.19
157 0.22
158 0.23
159 0.24
160 0.23
161 0.2
162 0.15
163 0.13
164 0.1
165 0.08
166 0.08
167 0.07
168 0.1
169 0.1
170 0.11
171 0.11
172 0.11
173 0.14
174 0.14
175 0.15
176 0.12
177 0.13
178 0.12
179 0.12
180 0.12
181 0.08
182 0.07
183 0.07
184 0.07
185 0.1
186 0.09
187 0.1
188 0.11
189 0.12
190 0.12
191 0.11
192 0.1
193 0.07
194 0.08
195 0.07
196 0.06
197 0.05
198 0.05
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.05
206 0.07
207 0.07
208 0.08
209 0.09
210 0.09
211 0.1
212 0.12
213 0.11
214 0.14
215 0.16
216 0.16
217 0.16
218 0.17
219 0.2
220 0.19
221 0.24
222 0.24
223 0.28
224 0.3
225 0.32
226 0.35
227 0.36
228 0.37
229 0.35
230 0.35
231 0.3
232 0.29
233 0.26
234 0.24
235 0.24
236 0.23
237 0.18
238 0.14
239 0.15
240 0.16
241 0.18
242 0.16
243 0.13
244 0.13
245 0.13
246 0.15
247 0.13
248 0.12
249 0.1
250 0.11
251 0.12
252 0.17
253 0.2
254 0.23
255 0.32
256 0.39
257 0.49
258 0.55
259 0.64
260 0.68
261 0.75
262 0.81
263 0.8