Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SQD6

Protein Details
Accession A0A5C2SQD6   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-86AEEAPKKDSKARHKARQARKAAAHydrophilic
NLS Segment(s)
PositionSequence
68-83PKKDSKARHKARQARK
Subcellular Location(s) cyto 8, cyto_nucl 8.5, mito 9, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR003323  OTU_dom  
IPR038765  Papain-like_cys_pep_sf  
Pfam View protein in Pfam  
PF02338  OTU  
PROSITE View protein in PROSITE  
PS50802  OTU  
CDD cd22748  OTU_OTUD6-like  
Amino Acid Sequences MAQKKNKLKKMLSPPQPAPVDDLVDDDALMDDLLAHLDSKDHVVREESATVLKEMQIDGVAQKAEEAPKKDSKARHKARQARKAAALAESYAPTDTEADARLERQAKEEEENIKRVCEELGLILHEITPDGHCLFSAVADQLALLGIIPQSDATFATCRAAAADYIYSHMDDFLPFLPSEVGEDAAGATDPGLMTREEFYRYCKTMRNTAAWGGEPEILALSRAFNVPIHVVQGGTPPVVVHDPRGDQESKPGDKRVVYISYHRRLYGLGEHYNSLRPKTLLNSIKSALH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.72
4 0.62
5 0.57
6 0.48
7 0.4
8 0.31
9 0.3
10 0.22
11 0.2
12 0.19
13 0.13
14 0.11
15 0.09
16 0.08
17 0.06
18 0.04
19 0.04
20 0.05
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.11
27 0.13
28 0.13
29 0.15
30 0.17
31 0.19
32 0.22
33 0.22
34 0.19
35 0.19
36 0.19
37 0.19
38 0.17
39 0.15
40 0.13
41 0.12
42 0.12
43 0.1
44 0.09
45 0.09
46 0.1
47 0.09
48 0.08
49 0.08
50 0.1
51 0.15
52 0.19
53 0.22
54 0.26
55 0.32
56 0.36
57 0.42
58 0.48
59 0.53
60 0.6
61 0.66
62 0.71
63 0.75
64 0.81
65 0.86
66 0.88
67 0.84
68 0.79
69 0.73
70 0.67
71 0.58
72 0.49
73 0.39
74 0.3
75 0.25
76 0.19
77 0.15
78 0.12
79 0.11
80 0.09
81 0.09
82 0.08
83 0.08
84 0.08
85 0.09
86 0.1
87 0.1
88 0.14
89 0.17
90 0.17
91 0.19
92 0.21
93 0.21
94 0.23
95 0.27
96 0.3
97 0.29
98 0.34
99 0.31
100 0.29
101 0.27
102 0.25
103 0.21
104 0.13
105 0.11
106 0.07
107 0.07
108 0.07
109 0.08
110 0.07
111 0.07
112 0.07
113 0.06
114 0.06
115 0.05
116 0.06
117 0.06
118 0.06
119 0.05
120 0.06
121 0.06
122 0.06
123 0.06
124 0.05
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.03
131 0.02
132 0.02
133 0.02
134 0.02
135 0.03
136 0.03
137 0.03
138 0.03
139 0.04
140 0.05
141 0.05
142 0.06
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.06
149 0.06
150 0.07
151 0.07
152 0.08
153 0.08
154 0.08
155 0.07
156 0.08
157 0.07
158 0.06
159 0.07
160 0.06
161 0.08
162 0.07
163 0.08
164 0.08
165 0.07
166 0.09
167 0.08
168 0.08
169 0.06
170 0.06
171 0.05
172 0.05
173 0.05
174 0.04
175 0.03
176 0.03
177 0.03
178 0.03
179 0.05
180 0.05
181 0.06
182 0.07
183 0.09
184 0.12
185 0.12
186 0.17
187 0.22
188 0.25
189 0.26
190 0.31
191 0.33
192 0.39
193 0.43
194 0.42
195 0.39
196 0.41
197 0.41
198 0.35
199 0.33
200 0.26
201 0.23
202 0.18
203 0.15
204 0.12
205 0.09
206 0.09
207 0.08
208 0.07
209 0.07
210 0.07
211 0.08
212 0.08
213 0.1
214 0.11
215 0.11
216 0.13
217 0.12
218 0.11
219 0.11
220 0.14
221 0.14
222 0.12
223 0.11
224 0.09
225 0.11
226 0.14
227 0.14
228 0.14
229 0.17
230 0.18
231 0.2
232 0.25
233 0.25
234 0.22
235 0.3
236 0.36
237 0.38
238 0.41
239 0.43
240 0.42
241 0.41
242 0.43
243 0.41
244 0.37
245 0.34
246 0.4
247 0.46
248 0.5
249 0.52
250 0.5
251 0.44
252 0.4
253 0.41
254 0.4
255 0.36
256 0.34
257 0.34
258 0.35
259 0.36
260 0.43
261 0.41
262 0.35
263 0.33
264 0.27
265 0.28
266 0.31
267 0.4
268 0.41
269 0.43
270 0.46