Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SUZ8

Protein Details
Accession A0A5C2SUZ8   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
251-293LRDRDDRRVPPPRRDSPPRREAGWGRRGASRSRSPPRRRGRYDBasic
NLS Segment(s)
PositionSequence
228-291GPAPRGGRVGRGDFGRDRDRDRDLRDRDDRRVPPPRRDSPPRREAGWGRRGASRSRSPPRRRGR
Subcellular Location(s) cyto 9.5, cyto_nucl 11, mito 3, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MEDTTPAGKPIVDREKTAPFLIRTFVKIGTYHRLNQFQDGPLPVADEQQIYTWRDATLREVLTTLRSAASNSTEYRHPLARYSFRAVFADSASRGRFAQKDLGTVYSRDILGEPGSLDHPAPRLLEDTETESATNAEQDRTLDELRFVPGDYLCVMVQLPKGVTVPSGPGGELSIKGSAVAPANGWKSAGGGRGDAGWGGSVATNPGPGSGMGRGGGGHWRGNSNPEGPAPRGGRVGRGDFGRDRDRDRDLRDRDDRRVPPPRRDSPPRREAGWGRRGASRSRSPPRRRGRYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.47
4 0.48
5 0.44
6 0.36
7 0.36
8 0.37
9 0.35
10 0.3
11 0.3
12 0.28
13 0.25
14 0.25
15 0.28
16 0.33
17 0.35
18 0.39
19 0.43
20 0.49
21 0.48
22 0.51
23 0.51
24 0.44
25 0.43
26 0.39
27 0.33
28 0.26
29 0.27
30 0.22
31 0.19
32 0.18
33 0.14
34 0.13
35 0.14
36 0.18
37 0.18
38 0.18
39 0.18
40 0.17
41 0.18
42 0.18
43 0.19
44 0.21
45 0.2
46 0.19
47 0.19
48 0.19
49 0.2
50 0.2
51 0.16
52 0.11
53 0.11
54 0.11
55 0.12
56 0.14
57 0.16
58 0.16
59 0.18
60 0.19
61 0.21
62 0.24
63 0.26
64 0.24
65 0.25
66 0.31
67 0.35
68 0.37
69 0.41
70 0.41
71 0.38
72 0.39
73 0.35
74 0.29
75 0.24
76 0.22
77 0.17
78 0.17
79 0.16
80 0.16
81 0.15
82 0.17
83 0.18
84 0.17
85 0.24
86 0.21
87 0.23
88 0.23
89 0.27
90 0.25
91 0.24
92 0.23
93 0.17
94 0.16
95 0.14
96 0.13
97 0.1
98 0.09
99 0.09
100 0.08
101 0.07
102 0.07
103 0.08
104 0.07
105 0.07
106 0.08
107 0.09
108 0.09
109 0.09
110 0.1
111 0.1
112 0.11
113 0.11
114 0.14
115 0.14
116 0.14
117 0.13
118 0.12
119 0.11
120 0.1
121 0.11
122 0.08
123 0.07
124 0.07
125 0.07
126 0.08
127 0.1
128 0.11
129 0.09
130 0.1
131 0.1
132 0.1
133 0.11
134 0.1
135 0.08
136 0.07
137 0.08
138 0.07
139 0.08
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.06
148 0.07
149 0.07
150 0.07
151 0.06
152 0.07
153 0.08
154 0.08
155 0.07
156 0.07
157 0.08
158 0.08
159 0.08
160 0.08
161 0.07
162 0.07
163 0.07
164 0.07
165 0.08
166 0.08
167 0.08
168 0.07
169 0.1
170 0.12
171 0.11
172 0.11
173 0.1
174 0.1
175 0.11
176 0.15
177 0.12
178 0.11
179 0.11
180 0.11
181 0.11
182 0.1
183 0.09
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.05
190 0.05
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.08
197 0.08
198 0.08
199 0.08
200 0.08
201 0.08
202 0.08
203 0.13
204 0.13
205 0.14
206 0.15
207 0.17
208 0.17
209 0.21
210 0.23
211 0.2
212 0.2
213 0.21
214 0.24
215 0.24
216 0.31
217 0.29
218 0.28
219 0.32
220 0.3
221 0.33
222 0.33
223 0.35
224 0.31
225 0.3
226 0.33
227 0.31
228 0.37
229 0.39
230 0.37
231 0.39
232 0.4
233 0.45
234 0.47
235 0.51
236 0.55
237 0.53
238 0.6
239 0.65
240 0.66
241 0.66
242 0.7
243 0.68
244 0.67
245 0.72
246 0.7
247 0.7
248 0.74
249 0.76
250 0.76
251 0.82
252 0.83
253 0.83
254 0.86
255 0.8
256 0.73
257 0.72
258 0.72
259 0.71
260 0.7
261 0.66
262 0.58
263 0.6
264 0.6
265 0.58
266 0.58
267 0.58
268 0.58
269 0.63
270 0.72
271 0.75
272 0.82
273 0.87