Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SML0

Protein Details
Accession A0A5C2SML0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-29LLPHIRHVIRRRLRGCRNNRVCRLSPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 2, cyto_mito 8.833, cyto_nucl 1.833, golg 2, mito 14.5, pero 2, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045340  DUF6533  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20151  DUF6533  
Amino Acid Sequences MHCLLPHIRHVIRRRLRGCRNNRVCRLSPDAYVALFSIVFFIYDYIITIGREVDLFWTRKVTGASVLFLFIRYGTLVYKILDLVSYGPMSDKLCNASASMHHDRNSPISPVCCLRWDAGLGID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.72
3 0.79
4 0.81
5 0.84
6 0.84
7 0.86
8 0.87
9 0.88
10 0.85
11 0.78
12 0.73
13 0.71
14 0.62
15 0.53
16 0.46
17 0.39
18 0.31
19 0.28
20 0.22
21 0.14
22 0.11
23 0.1
24 0.07
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.05
38 0.06
39 0.05
40 0.07
41 0.11
42 0.12
43 0.12
44 0.14
45 0.13
46 0.15
47 0.16
48 0.13
49 0.13
50 0.12
51 0.13
52 0.11
53 0.12
54 0.1
55 0.1
56 0.1
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.09
76 0.11
77 0.11
78 0.11
79 0.12
80 0.14
81 0.15
82 0.15
83 0.14
84 0.16
85 0.23
86 0.29
87 0.3
88 0.3
89 0.32
90 0.33
91 0.37
92 0.37
93 0.32
94 0.29
95 0.27
96 0.29
97 0.31
98 0.31
99 0.29
100 0.28
101 0.26
102 0.25
103 0.25