Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2RUS5

Protein Details
Accession A0A5C2RUS5    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-28ASLTSRISYCPRKRPRWSSVPAMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 10.833, nucl 5.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036852  Peptidase_S8/S53_dom_sf  
Gene Ontology GO:0004252  F:serine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Amino Acid Sequences MQARSASLTSRISYCPRKRPRWSSVPAMASTKMVSRSTFPSQSFSATSAQLGSRGTTVLFCSGDNGVYSFPSNSTCDATTFGPTFPRGCPFLTSVGGTQGVTPEVAASFSSGGLLEHLRVSNVSRRRCGRASLRCRTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.53
3 0.6
4 0.69
5 0.77
6 0.82
7 0.84
8 0.84
9 0.81
10 0.8
11 0.77
12 0.72
13 0.64
14 0.57
15 0.49
16 0.39
17 0.34
18 0.28
19 0.23
20 0.2
21 0.18
22 0.18
23 0.23
24 0.28
25 0.32
26 0.3
27 0.31
28 0.3
29 0.32
30 0.3
31 0.26
32 0.22
33 0.17
34 0.16
35 0.14
36 0.13
37 0.12
38 0.11
39 0.1
40 0.08
41 0.08
42 0.08
43 0.07
44 0.07
45 0.08
46 0.08
47 0.07
48 0.08
49 0.08
50 0.09
51 0.08
52 0.08
53 0.06
54 0.06
55 0.07
56 0.06
57 0.06
58 0.07
59 0.08
60 0.09
61 0.1
62 0.1
63 0.11
64 0.13
65 0.13
66 0.14
67 0.14
68 0.13
69 0.13
70 0.13
71 0.14
72 0.13
73 0.15
74 0.15
75 0.15
76 0.16
77 0.16
78 0.18
79 0.18
80 0.18
81 0.16
82 0.16
83 0.16
84 0.14
85 0.12
86 0.1
87 0.09
88 0.08
89 0.07
90 0.06
91 0.05
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.07
101 0.07
102 0.07
103 0.09
104 0.09
105 0.1
106 0.11
107 0.14
108 0.21
109 0.28
110 0.33
111 0.39
112 0.44
113 0.51
114 0.54
115 0.59
116 0.61
117 0.65
118 0.69