Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2S242

Protein Details
Accession A0A5C2S242    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-65SSSPYGRTHVWKRRPKKMPNPVVPVFHydrophilic
NLS Segment(s)
PositionSequence
157-162KAKGKK
Subcellular Location(s) mito 18.5, cyto_mito 10.333, nucl 5.5, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MSLLSLLPSTSRATCASSFAPAKSSLSLSSIHQTQTRSVSSSPYGRTHVWKRRPKKMPNPVVPVFPQRLVRVDGSTIIHYTTSPRSVIKLTRDTTNNPVWNAARFVGMDEEEDEVTGRLGRFSRRFGDLGGEGEKTGMEWMNEASGTEEAKHVSEGKAKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.22
4 0.26
5 0.27
6 0.25
7 0.26
8 0.24
9 0.25
10 0.22
11 0.23
12 0.17
13 0.16
14 0.17
15 0.17
16 0.2
17 0.2
18 0.2
19 0.22
20 0.22
21 0.24
22 0.27
23 0.26
24 0.25
25 0.23
26 0.24
27 0.25
28 0.29
29 0.29
30 0.28
31 0.3
32 0.29
33 0.36
34 0.43
35 0.49
36 0.54
37 0.61
38 0.66
39 0.73
40 0.81
41 0.83
42 0.84
43 0.85
44 0.86
45 0.85
46 0.85
47 0.76
48 0.69
49 0.61
50 0.55
51 0.46
52 0.38
53 0.31
54 0.24
55 0.24
56 0.23
57 0.22
58 0.18
59 0.16
60 0.16
61 0.15
62 0.14
63 0.12
64 0.1
65 0.09
66 0.08
67 0.1
68 0.1
69 0.1
70 0.1
71 0.1
72 0.11
73 0.13
74 0.17
75 0.2
76 0.25
77 0.25
78 0.29
79 0.31
80 0.33
81 0.36
82 0.39
83 0.37
84 0.3
85 0.32
86 0.28
87 0.27
88 0.26
89 0.21
90 0.15
91 0.12
92 0.13
93 0.11
94 0.11
95 0.1
96 0.09
97 0.1
98 0.09
99 0.09
100 0.08
101 0.07
102 0.07
103 0.08
104 0.07
105 0.08
106 0.1
107 0.16
108 0.18
109 0.22
110 0.25
111 0.27
112 0.28
113 0.27
114 0.31
115 0.26
116 0.26
117 0.24
118 0.21
119 0.17
120 0.17
121 0.16
122 0.11
123 0.11
124 0.09
125 0.07
126 0.08
127 0.08
128 0.1
129 0.1
130 0.1
131 0.1
132 0.1
133 0.11
134 0.11
135 0.12
136 0.12
137 0.13
138 0.14
139 0.14
140 0.16
141 0.22
142 0.27