Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LEI3

Protein Details
Accession E2LEI3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-52DDGKASRKSNAKPKPKEKEKEKEKEKSKAKBasic
NLS Segment(s)
PositionSequence
26-73KASRKSNAKPKPKEKEKEKEKEKSKAKGKGKERGEEKEPERPKPKRLR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
KEGG mpr:MPER_04742  -  
Amino Acid Sequences MGVVDDGMDDNSDIDGDGGIQSDDGKASRKSNAKPKPKEKEKEKEKEKSKAKGKGKERGEEKEPERPKPKRLRTSAYAETSDRSTRDSYTPTIPPTTSNSSNDDSASSNQSHPGSEIPDTEVGAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.06
11 0.07
12 0.1
13 0.12
14 0.15
15 0.22
16 0.28
17 0.35
18 0.44
19 0.54
20 0.61
21 0.68
22 0.77
23 0.81
24 0.85
25 0.88
26 0.87
27 0.88
28 0.88
29 0.88
30 0.86
31 0.85
32 0.82
33 0.82
34 0.8
35 0.79
36 0.77
37 0.76
38 0.75
39 0.75
40 0.74
41 0.73
42 0.7
43 0.68
44 0.63
45 0.59
46 0.54
47 0.52
48 0.48
49 0.48
50 0.46
51 0.46
52 0.5
53 0.48
54 0.53
55 0.57
56 0.65
57 0.65
58 0.68
59 0.68
60 0.64
61 0.7
62 0.67
63 0.61
64 0.53
65 0.44
66 0.4
67 0.36
68 0.32
69 0.24
70 0.2
71 0.17
72 0.17
73 0.19
74 0.21
75 0.21
76 0.24
77 0.26
78 0.26
79 0.28
80 0.26
81 0.25
82 0.28
83 0.33
84 0.32
85 0.31
86 0.33
87 0.34
88 0.34
89 0.33
90 0.28
91 0.24
92 0.23
93 0.24
94 0.22
95 0.2
96 0.23
97 0.24
98 0.23
99 0.21
100 0.21
101 0.2
102 0.2
103 0.21
104 0.19
105 0.2