Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2SJT6

Protein Details
Accession A0A5C2SJT6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-32LLNLWTQRMKRRPGRRRMPGNMGLQRHydrophilic
66-91QVHHHDSRRRGWKCRNERRLGSRGGCBasic
NLS Segment(s)
PositionSequence
15-46MKRRPGRRRMPGNMGLQRLKIRRTRQRTKAEG
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
Amino Acid Sequences MSACSMLLNLWTQRMKRRPGRRRMPGNMGLQRLKIRRTRQRTKAEGEKTRTRTLTNEESGRNSAEQVHHHDSRRRGWKCRNERRLGSRGGCSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.48
3 0.55
4 0.65
5 0.7
6 0.77
7 0.85
8 0.86
9 0.88
10 0.87
11 0.85
12 0.82
13 0.81
14 0.75
15 0.7
16 0.61
17 0.53
18 0.51
19 0.45
20 0.42
21 0.4
22 0.43
23 0.48
24 0.56
25 0.64
26 0.68
27 0.75
28 0.75
29 0.75
30 0.75
31 0.74
32 0.71
33 0.68
34 0.66
35 0.61
36 0.6
37 0.54
38 0.46
39 0.39
40 0.38
41 0.38
42 0.34
43 0.33
44 0.3
45 0.32
46 0.32
47 0.31
48 0.25
49 0.19
50 0.18
51 0.17
52 0.18
53 0.24
54 0.29
55 0.32
56 0.36
57 0.42
58 0.44
59 0.51
60 0.58
61 0.56
62 0.59
63 0.65
64 0.72
65 0.77
66 0.84
67 0.85
68 0.84
69 0.88
70 0.87
71 0.84
72 0.82
73 0.75
74 0.7