Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4TVF5

Protein Details
Accession G4TVF5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
94-117KAKMSAKKLARMRRRQGRTKKINGBasic
NLS Segment(s)
PositionSequence
69-117EIQRRKEITKERKERAEERKRLEEMKAKMSAKKLARMRRRQGRTKKING
Subcellular Location(s) mito 20.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MTSTSITLAASSSGRVSGKNWKTRKTATVRSNLPTGVKTKSWQERKRKDTQMAAVKALQKELKDEKLAEIQRRKEITKERKERAEERKRLEEMKAKMSAKKLARMRRRQGRTKKING
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.23
5 0.32
6 0.4
7 0.46
8 0.49
9 0.55
10 0.59
11 0.66
12 0.64
13 0.65
14 0.63
15 0.67
16 0.65
17 0.62
18 0.59
19 0.51
20 0.44
21 0.36
22 0.31
23 0.25
24 0.22
25 0.21
26 0.26
27 0.35
28 0.44
29 0.5
30 0.59
31 0.65
32 0.71
33 0.79
34 0.78
35 0.74
36 0.7
37 0.69
38 0.67
39 0.59
40 0.54
41 0.47
42 0.42
43 0.37
44 0.33
45 0.26
46 0.17
47 0.19
48 0.21
49 0.2
50 0.18
51 0.19
52 0.19
53 0.25
54 0.28
55 0.31
56 0.35
57 0.35
58 0.4
59 0.43
60 0.42
61 0.41
62 0.48
63 0.51
64 0.56
65 0.62
66 0.62
67 0.67
68 0.72
69 0.74
70 0.75
71 0.76
72 0.73
73 0.7
74 0.73
75 0.68
76 0.65
77 0.62
78 0.59
79 0.52
80 0.51
81 0.51
82 0.45
83 0.46
84 0.47
85 0.5
86 0.46
87 0.5
88 0.52
89 0.54
90 0.63
91 0.7
92 0.77
93 0.79
94 0.85
95 0.87
96 0.9
97 0.91