Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2RPD1

Protein Details
Accession A0A5C2RPD1   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-32SSISREKKTKEHKRALIQEVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 12.5, mito 22.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR043141  Ribosomal_L10-like_sf  
IPR001790  Ribosomal_L10P  
Pfam View protein in Pfam  
PF00466  Ribosomal_L10  
Amino Acid Sequences MKTFAAATVIKISSISREKKTKEHKRALIQEVQEHADKWQYCWLFEVTNMRNAHLKTARKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.31
4 0.38
5 0.41
6 0.5
7 0.61
8 0.65
9 0.68
10 0.73
11 0.74
12 0.76
13 0.81
14 0.76
15 0.71
16 0.61
17 0.53
18 0.45
19 0.39
20 0.31
21 0.23
22 0.18
23 0.18
24 0.17
25 0.16
26 0.2
27 0.19
28 0.19
29 0.21
30 0.22
31 0.17
32 0.19
33 0.27
34 0.22
35 0.29
36 0.29
37 0.28
38 0.32
39 0.32
40 0.39
41 0.38