Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2RLE4

Protein Details
Accession A0A5C2RLE4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MITGYKKKRLGHPSKRLFGDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR003440  Glyco_trans_48  
Gene Ontology GO:0000148  C:1,3-beta-D-glucan synthase complex  
GO:0003843  F:1,3-beta-D-glucan synthase activity  
GO:0006075  P:(1->3)-beta-D-glucan biosynthetic process  
Pfam View protein in Pfam  
PF02364  Glucan_synthase  
Amino Acid Sequences MITGYKKKRLGHPSKRLFGDVPREKWRAVIFSEIIFPIIMAVLFVIVYMFVKAFPDKDGKQLPSLLACIAIISLGPVVWNAAVILVLFMSSLSLGLML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.73
4 0.64
5 0.59
6 0.59
7 0.56
8 0.53
9 0.52
10 0.52
11 0.49
12 0.5
13 0.45
14 0.37
15 0.3
16 0.28
17 0.21
18 0.2
19 0.21
20 0.18
21 0.16
22 0.13
23 0.11
24 0.07
25 0.06
26 0.05
27 0.03
28 0.03
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.05
41 0.07
42 0.12
43 0.12
44 0.18
45 0.23
46 0.24
47 0.25
48 0.26
49 0.25
50 0.21
51 0.21
52 0.16
53 0.11
54 0.09
55 0.08
56 0.06
57 0.05
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03