Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2RZ47

Protein Details
Accession A0A5C2RZ47   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
162-184WLFFTSRRIRRLRRQTRLSQELLHydrophilic
349-369PSKRRRFVFFRPTLRKQRHKTBasic
557-585ARVEVPPPTRGRRRGRGWRRARLYPSPVGHydrophilic
NLS Segment(s)
PositionSequence
565-578TRGRRRGRGWRRAR
Subcellular Location(s) E.R. 2, extr 7, nucl 3, pero 2, plas 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
CDD cd16448  RING-H2  
Amino Acid Sequences MSDNAASPDGIALATLPAAAARSNPPRNAEATSPASPEPRMPLANAGNSVTVTQPQPQPQPQPQPTTAYGRAWRKVLEVLGYTGPSRSAQRERRRLVQYLTVVVLSLAQVIVIVVLTAVGGVRKSPHPEHPGQTELGACAILGAWNLIWLGRLILRLYLISWLFFTSRRIRRLRRQTRLSQELLANTAPAGNPAAVGEATLTRMPTSADATCPISWRVFHVLLYKLEPFLTIVWWFSAILVIYAHGPPCRQAAPDISAATYTIVILVYGNFMLTTFVPMIRMISARRQAGRPSINKLSRAEVDRIPLVLYIPPPPGDAPTSPTSPLTPLPSALSHSPISPRRPTPTPTPSKRRRFVFFRPTLRKQRHKTQTQTQTDVEIEQHAPPDSDLPTTTSPAGGNDMMVDEWEQTFGPAAYPFVRLPENQATCGICLVEFEAPRRLNGRDRNADEDDDDDKDDGHEGDAHELELGALPRLEQAQGERAGGRAGADSDGGTQTITEVRVESPRPTDAGALQLADSDNSDAPEPLRLLSCGHVYHKDCVDQWLTQKSGRCPYCQARVEVPPPTRGRRRGRGWRRARLYPSPVGLPTFRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.06
6 0.06
7 0.08
8 0.15
9 0.25
10 0.31
11 0.35
12 0.39
13 0.41
14 0.44
15 0.46
16 0.42
17 0.39
18 0.39
19 0.38
20 0.37
21 0.36
22 0.36
23 0.33
24 0.32
25 0.3
26 0.28
27 0.27
28 0.25
29 0.31
30 0.33
31 0.35
32 0.35
33 0.31
34 0.27
35 0.26
36 0.25
37 0.19
38 0.17
39 0.16
40 0.19
41 0.23
42 0.28
43 0.36
44 0.41
45 0.49
46 0.55
47 0.64
48 0.65
49 0.68
50 0.64
51 0.63
52 0.6
53 0.6
54 0.55
55 0.5
56 0.52
57 0.52
58 0.53
59 0.49
60 0.46
61 0.4
62 0.4
63 0.36
64 0.31
65 0.25
66 0.24
67 0.24
68 0.24
69 0.22
70 0.19
71 0.18
72 0.16
73 0.17
74 0.21
75 0.29
76 0.38
77 0.49
78 0.59
79 0.63
80 0.71
81 0.74
82 0.72
83 0.66
84 0.64
85 0.57
86 0.49
87 0.45
88 0.35
89 0.29
90 0.24
91 0.2
92 0.12
93 0.09
94 0.06
95 0.04
96 0.04
97 0.04
98 0.04
99 0.03
100 0.03
101 0.02
102 0.02
103 0.02
104 0.02
105 0.03
106 0.03
107 0.03
108 0.04
109 0.07
110 0.11
111 0.17
112 0.21
113 0.29
114 0.36
115 0.42
116 0.46
117 0.48
118 0.48
119 0.43
120 0.4
121 0.32
122 0.25
123 0.2
124 0.15
125 0.1
126 0.07
127 0.06
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.04
135 0.05
136 0.04
137 0.05
138 0.06
139 0.08
140 0.08
141 0.09
142 0.09
143 0.09
144 0.09
145 0.12
146 0.11
147 0.1
148 0.1
149 0.11
150 0.11
151 0.12
152 0.16
153 0.22
154 0.29
155 0.37
156 0.45
157 0.52
158 0.62
159 0.72
160 0.79
161 0.79
162 0.81
163 0.83
164 0.84
165 0.83
166 0.75
167 0.67
168 0.58
169 0.49
170 0.43
171 0.33
172 0.23
173 0.16
174 0.15
175 0.1
176 0.09
177 0.08
178 0.06
179 0.06
180 0.06
181 0.07
182 0.06
183 0.06
184 0.06
185 0.05
186 0.07
187 0.07
188 0.07
189 0.06
190 0.07
191 0.07
192 0.08
193 0.11
194 0.1
195 0.1
196 0.12
197 0.15
198 0.15
199 0.17
200 0.17
201 0.15
202 0.14
203 0.16
204 0.19
205 0.17
206 0.18
207 0.2
208 0.22
209 0.23
210 0.25
211 0.23
212 0.18
213 0.17
214 0.16
215 0.13
216 0.09
217 0.1
218 0.08
219 0.07
220 0.07
221 0.08
222 0.07
223 0.06
224 0.07
225 0.06
226 0.06
227 0.05
228 0.05
229 0.06
230 0.07
231 0.07
232 0.07
233 0.07
234 0.08
235 0.1
236 0.11
237 0.1
238 0.11
239 0.13
240 0.16
241 0.19
242 0.18
243 0.16
244 0.15
245 0.15
246 0.13
247 0.1
248 0.07
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.03
258 0.03
259 0.04
260 0.04
261 0.05
262 0.05
263 0.05
264 0.06
265 0.06
266 0.07
267 0.07
268 0.08
269 0.08
270 0.12
271 0.17
272 0.18
273 0.2
274 0.21
275 0.22
276 0.28
277 0.34
278 0.31
279 0.33
280 0.39
281 0.4
282 0.41
283 0.41
284 0.37
285 0.33
286 0.34
287 0.31
288 0.24
289 0.23
290 0.2
291 0.19
292 0.17
293 0.14
294 0.11
295 0.09
296 0.09
297 0.09
298 0.09
299 0.1
300 0.1
301 0.1
302 0.11
303 0.11
304 0.11
305 0.13
306 0.15
307 0.16
308 0.16
309 0.16
310 0.16
311 0.15
312 0.17
313 0.16
314 0.13
315 0.13
316 0.14
317 0.14
318 0.15
319 0.14
320 0.16
321 0.13
322 0.14
323 0.19
324 0.22
325 0.26
326 0.29
327 0.31
328 0.33
329 0.36
330 0.39
331 0.42
332 0.47
333 0.53
334 0.57
335 0.65
336 0.7
337 0.76
338 0.8
339 0.76
340 0.73
341 0.7
342 0.71
343 0.72
344 0.71
345 0.71
346 0.73
347 0.76
348 0.8
349 0.81
350 0.82
351 0.77
352 0.79
353 0.79
354 0.79
355 0.78
356 0.78
357 0.8
358 0.76
359 0.74
360 0.64
361 0.56
362 0.48
363 0.41
364 0.31
365 0.22
366 0.17
367 0.13
368 0.14
369 0.12
370 0.11
371 0.11
372 0.12
373 0.1
374 0.1
375 0.1
376 0.12
377 0.13
378 0.15
379 0.15
380 0.14
381 0.13
382 0.12
383 0.15
384 0.11
385 0.1
386 0.08
387 0.09
388 0.08
389 0.08
390 0.07
391 0.05
392 0.05
393 0.06
394 0.06
395 0.05
396 0.06
397 0.06
398 0.07
399 0.06
400 0.08
401 0.08
402 0.11
403 0.11
404 0.13
405 0.14
406 0.13
407 0.19
408 0.27
409 0.28
410 0.26
411 0.29
412 0.27
413 0.25
414 0.26
415 0.2
416 0.1
417 0.09
418 0.1
419 0.11
420 0.11
421 0.13
422 0.2
423 0.2
424 0.21
425 0.24
426 0.25
427 0.3
428 0.38
429 0.45
430 0.47
431 0.5
432 0.55
433 0.55
434 0.54
435 0.46
436 0.41
437 0.34
438 0.26
439 0.23
440 0.17
441 0.14
442 0.13
443 0.13
444 0.11
445 0.09
446 0.1
447 0.1
448 0.13
449 0.13
450 0.12
451 0.11
452 0.11
453 0.1
454 0.1
455 0.1
456 0.07
457 0.07
458 0.07
459 0.08
460 0.09
461 0.09
462 0.08
463 0.1
464 0.15
465 0.17
466 0.18
467 0.17
468 0.17
469 0.17
470 0.16
471 0.14
472 0.1
473 0.09
474 0.08
475 0.08
476 0.08
477 0.1
478 0.1
479 0.1
480 0.08
481 0.07
482 0.08
483 0.09
484 0.1
485 0.09
486 0.09
487 0.11
488 0.16
489 0.19
490 0.21
491 0.22
492 0.23
493 0.24
494 0.24
495 0.24
496 0.2
497 0.21
498 0.19
499 0.17
500 0.15
501 0.15
502 0.14
503 0.13
504 0.13
505 0.11
506 0.11
507 0.11
508 0.12
509 0.11
510 0.11
511 0.15
512 0.15
513 0.14
514 0.15
515 0.15
516 0.15
517 0.17
518 0.21
519 0.2
520 0.24
521 0.3
522 0.32
523 0.37
524 0.39
525 0.4
526 0.36
527 0.39
528 0.38
529 0.34
530 0.36
531 0.38
532 0.38
533 0.38
534 0.43
535 0.45
536 0.51
537 0.5
538 0.48
539 0.5
540 0.55
541 0.61
542 0.6
543 0.59
544 0.55
545 0.6
546 0.62
547 0.62
548 0.57
549 0.56
550 0.57
551 0.62
552 0.64
553 0.66
554 0.71
555 0.72
556 0.8
557 0.82
558 0.87
559 0.89
560 0.9
561 0.91
562 0.89
563 0.88
564 0.86
565 0.84
566 0.8
567 0.77
568 0.7
569 0.64
570 0.58
571 0.53