Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SGP5

Protein Details
Accession A0A5C2SGP5   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
197-217PAAVREKKKAERRKWSTRLDAHydrophilic
NLS Segment(s)
PositionSequence
202-210EKKKAERRK
Subcellular Location(s) E.R. 3, mito 1, mito_nucl 1, nucl 1, plas 21, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR026749  Tmem135  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKPSDLRKRLNDAPHDLADFLHSLPDDHPLQIGLRTYTLALSLALGPAFLPFLTSPKARAQGFKRVLHILKREISINAFASAITVGVAGGAAIRHIWNMWEERMHETGSGEPKDAFGKVRAWLASLKDGQKTFLSNVISSTLAVTLLHSRRRHAASMWVGRPSPTLDLSLLFLVRAMDSLVQLALFKPSETSESLLPAAVREKKKAERRKWSTRLDALVFWACSARIMWCFFYEPDMLPRSYNKWIMTVANIDPRILMALRGIRDGTYSYKRGTSSPPDLLTSFSQTLGYPAAWGDPAQLPAYGGPAADRMWQKIGVANRSGRGGIPCELVHGGVTGGSCTANAGIRGIQAFAEAVALYLPVHVLPILLTCPRRLLEAPKLVSTLLSVARSASFLSAFVSSIWFAVCCTRTLVLARLFPWIPHDFWDGPYGCTFVGSLVCGASIWIERGRRRGEMALYVLPRAIRACLPEKWLKSGRPSVRWAERLIFILSLSTLLTAAIHRPDTLRGLSRWTLAFVMKGPNAGFWRRRRLGTNAPPTPASPTRAPTPPKEDDTQANA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.58
3 0.5
4 0.42
5 0.35
6 0.28
7 0.2
8 0.17
9 0.13
10 0.13
11 0.13
12 0.19
13 0.18
14 0.17
15 0.18
16 0.16
17 0.17
18 0.19
19 0.21
20 0.17
21 0.16
22 0.16
23 0.16
24 0.15
25 0.15
26 0.12
27 0.1
28 0.1
29 0.09
30 0.1
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.06
37 0.08
38 0.07
39 0.1
40 0.15
41 0.16
42 0.19
43 0.25
44 0.32
45 0.32
46 0.4
47 0.42
48 0.49
49 0.56
50 0.57
51 0.55
52 0.56
53 0.59
54 0.58
55 0.59
56 0.55
57 0.52
58 0.5
59 0.48
60 0.42
61 0.39
62 0.35
63 0.31
64 0.25
65 0.2
66 0.17
67 0.16
68 0.14
69 0.11
70 0.07
71 0.05
72 0.04
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.05
82 0.05
83 0.07
84 0.09
85 0.13
86 0.14
87 0.17
88 0.19
89 0.22
90 0.24
91 0.24
92 0.21
93 0.19
94 0.23
95 0.27
96 0.26
97 0.23
98 0.21
99 0.22
100 0.23
101 0.23
102 0.2
103 0.16
104 0.17
105 0.18
106 0.22
107 0.21
108 0.21
109 0.23
110 0.23
111 0.26
112 0.29
113 0.3
114 0.31
115 0.31
116 0.31
117 0.3
118 0.3
119 0.25
120 0.25
121 0.24
122 0.19
123 0.2
124 0.2
125 0.18
126 0.16
127 0.15
128 0.1
129 0.08
130 0.08
131 0.08
132 0.14
133 0.18
134 0.25
135 0.25
136 0.27
137 0.34
138 0.37
139 0.38
140 0.32
141 0.36
142 0.38
143 0.46
144 0.47
145 0.43
146 0.4
147 0.39
148 0.38
149 0.31
150 0.25
151 0.17
152 0.16
153 0.13
154 0.13
155 0.14
156 0.14
157 0.12
158 0.09
159 0.09
160 0.08
161 0.07
162 0.06
163 0.06
164 0.05
165 0.05
166 0.06
167 0.05
168 0.05
169 0.05
170 0.06
171 0.07
172 0.07
173 0.07
174 0.07
175 0.08
176 0.1
177 0.11
178 0.13
179 0.11
180 0.13
181 0.13
182 0.13
183 0.12
184 0.1
185 0.14
186 0.2
187 0.21
188 0.23
189 0.28
190 0.36
191 0.46
192 0.56
193 0.6
194 0.64
195 0.72
196 0.8
197 0.83
198 0.82
199 0.8
200 0.74
201 0.69
202 0.6
203 0.51
204 0.43
205 0.36
206 0.29
207 0.21
208 0.17
209 0.12
210 0.1
211 0.1
212 0.08
213 0.09
214 0.1
215 0.11
216 0.11
217 0.13
218 0.13
219 0.15
220 0.15
221 0.13
222 0.15
223 0.17
224 0.17
225 0.16
226 0.17
227 0.19
228 0.21
229 0.24
230 0.21
231 0.2
232 0.21
233 0.2
234 0.2
235 0.19
236 0.17
237 0.19
238 0.18
239 0.17
240 0.15
241 0.14
242 0.14
243 0.11
244 0.1
245 0.06
246 0.08
247 0.09
248 0.1
249 0.1
250 0.09
251 0.09
252 0.11
253 0.14
254 0.15
255 0.16
256 0.17
257 0.19
258 0.2
259 0.21
260 0.24
261 0.25
262 0.26
263 0.28
264 0.28
265 0.27
266 0.26
267 0.27
268 0.23
269 0.21
270 0.16
271 0.13
272 0.13
273 0.11
274 0.12
275 0.11
276 0.1
277 0.06
278 0.06
279 0.06
280 0.06
281 0.06
282 0.07
283 0.07
284 0.08
285 0.08
286 0.08
287 0.08
288 0.08
289 0.09
290 0.07
291 0.06
292 0.05
293 0.06
294 0.06
295 0.11
296 0.11
297 0.11
298 0.13
299 0.13
300 0.13
301 0.16
302 0.19
303 0.17
304 0.2
305 0.2
306 0.2
307 0.2
308 0.2
309 0.18
310 0.16
311 0.15
312 0.13
313 0.14
314 0.13
315 0.13
316 0.13
317 0.12
318 0.11
319 0.09
320 0.07
321 0.06
322 0.06
323 0.04
324 0.04
325 0.04
326 0.04
327 0.04
328 0.05
329 0.05
330 0.05
331 0.06
332 0.06
333 0.07
334 0.07
335 0.07
336 0.06
337 0.06
338 0.06
339 0.05
340 0.05
341 0.04
342 0.04
343 0.03
344 0.04
345 0.03
346 0.03
347 0.03
348 0.03
349 0.03
350 0.03
351 0.03
352 0.03
353 0.04
354 0.06
355 0.09
356 0.1
357 0.1
358 0.13
359 0.13
360 0.15
361 0.16
362 0.21
363 0.26
364 0.33
365 0.35
366 0.34
367 0.34
368 0.32
369 0.3
370 0.24
371 0.18
372 0.12
373 0.11
374 0.1
375 0.1
376 0.1
377 0.11
378 0.11
379 0.09
380 0.07
381 0.06
382 0.08
383 0.08
384 0.08
385 0.07
386 0.08
387 0.08
388 0.08
389 0.08
390 0.06
391 0.06
392 0.1
393 0.11
394 0.1
395 0.12
396 0.13
397 0.14
398 0.16
399 0.21
400 0.2
401 0.22
402 0.22
403 0.24
404 0.24
405 0.23
406 0.26
407 0.24
408 0.21
409 0.21
410 0.26
411 0.22
412 0.23
413 0.3
414 0.25
415 0.24
416 0.24
417 0.22
418 0.16
419 0.16
420 0.14
421 0.09
422 0.09
423 0.08
424 0.07
425 0.06
426 0.07
427 0.06
428 0.06
429 0.06
430 0.06
431 0.08
432 0.12
433 0.17
434 0.2
435 0.27
436 0.31
437 0.31
438 0.34
439 0.36
440 0.35
441 0.34
442 0.36
443 0.35
444 0.33
445 0.31
446 0.29
447 0.25
448 0.23
449 0.19
450 0.17
451 0.12
452 0.16
453 0.21
454 0.22
455 0.29
456 0.35
457 0.37
458 0.43
459 0.48
460 0.47
461 0.5
462 0.57
463 0.58
464 0.57
465 0.61
466 0.62
467 0.64
468 0.63
469 0.59
470 0.53
471 0.47
472 0.44
473 0.4
474 0.31
475 0.22
476 0.2
477 0.16
478 0.13
479 0.1
480 0.08
481 0.06
482 0.06
483 0.06
484 0.06
485 0.09
486 0.12
487 0.13
488 0.14
489 0.15
490 0.18
491 0.21
492 0.25
493 0.27
494 0.24
495 0.3
496 0.32
497 0.34
498 0.32
499 0.3
500 0.28
501 0.24
502 0.24
503 0.2
504 0.25
505 0.22
506 0.25
507 0.23
508 0.26
509 0.29
510 0.35
511 0.41
512 0.42
513 0.52
514 0.54
515 0.59
516 0.59
517 0.63
518 0.67
519 0.69
520 0.72
521 0.67
522 0.65
523 0.62
524 0.58
525 0.58
526 0.51
527 0.46
528 0.4
529 0.38
530 0.41
531 0.48
532 0.52
533 0.52
534 0.56
535 0.58
536 0.59
537 0.59
538 0.57