Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2RTH4

Protein Details
Accession A0A5C2RTH4   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
84-124MGQEYQPSQRKRKRKHGFLTRKRSVNGRKMLARRKAKGRLYHydrophilic
NLS Segment(s)
PositionSequence
93-122RKRKRKHGFLTRKRSVNGRKMLARRKAKGR
Subcellular Location(s) cyto_nucl 4.833, mito 17.5, mito_nucl 12.833, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPPSLARLLTRPPVLPAAVPRATSSSSFASSLVPLRPLLPSTLPTSSLLCALPSLLSRFNPTPSIASSVFSPLLQVRHTTMGQEYQPSQRKRKRKHGFLTRKRSVNGRKMLARRKAKGRLYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.31
4 0.29
5 0.28
6 0.26
7 0.27
8 0.27
9 0.26
10 0.25
11 0.24
12 0.25
13 0.24
14 0.24
15 0.19
16 0.18
17 0.18
18 0.18
19 0.16
20 0.16
21 0.17
22 0.15
23 0.14
24 0.12
25 0.12
26 0.13
27 0.13
28 0.13
29 0.12
30 0.13
31 0.15
32 0.16
33 0.16
34 0.17
35 0.17
36 0.15
37 0.15
38 0.13
39 0.1
40 0.09
41 0.08
42 0.07
43 0.07
44 0.08
45 0.08
46 0.08
47 0.12
48 0.13
49 0.14
50 0.15
51 0.15
52 0.14
53 0.14
54 0.18
55 0.15
56 0.15
57 0.14
58 0.14
59 0.14
60 0.12
61 0.12
62 0.09
63 0.1
64 0.1
65 0.11
66 0.11
67 0.14
68 0.14
69 0.14
70 0.14
71 0.16
72 0.16
73 0.18
74 0.19
75 0.24
76 0.32
77 0.37
78 0.46
79 0.51
80 0.61
81 0.68
82 0.77
83 0.79
84 0.81
85 0.87
86 0.88
87 0.91
88 0.92
89 0.93
90 0.9
91 0.86
92 0.77
93 0.76
94 0.74
95 0.72
96 0.7
97 0.67
98 0.67
99 0.7
100 0.78
101 0.78
102 0.78
103 0.77
104 0.78
105 0.8
106 0.79
107 0.79