Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2S3C7

Protein Details
Accession A0A5C2S3C7   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-46GSTHPTPTGHTPRRPRRPMRAGVAVSHydrophilic
183-204VVDPCKRDWEKAKRIKRIDFLCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 11, mito 6, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MPGRRVHFADETAPPSESRSGSTHPTPTGHTPRRPRRPMRAGVAVSLPGPYLGTPPAQIILHPLLAATNGDAPLDWDMSLPAEASRVHLARYPPQLVDTVVCQPATNPAMQCVAIICNHLPWTITVTPTPSATWTAPYVTVGDVLHTLYRTLRLGVTSAELGVLDAPRQRRVTAAYIGRYRRVVDPCKRDWEKAKRIKRIDFLCDRRAFLGISLVEGGIPSRGLPHGAVWLLHTPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.29
4 0.25
5 0.23
6 0.24
7 0.25
8 0.3
9 0.35
10 0.36
11 0.35
12 0.36
13 0.37
14 0.42
15 0.49
16 0.51
17 0.55
18 0.62
19 0.7
20 0.79
21 0.85
22 0.85
23 0.85
24 0.86
25 0.86
26 0.83
27 0.81
28 0.72
29 0.64
30 0.57
31 0.47
32 0.37
33 0.29
34 0.21
35 0.11
36 0.1
37 0.08
38 0.07
39 0.07
40 0.08
41 0.08
42 0.09
43 0.11
44 0.11
45 0.11
46 0.13
47 0.14
48 0.13
49 0.13
50 0.12
51 0.1
52 0.1
53 0.1
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.08
61 0.08
62 0.08
63 0.06
64 0.06
65 0.07
66 0.07
67 0.06
68 0.05
69 0.06
70 0.06
71 0.08
72 0.11
73 0.11
74 0.12
75 0.15
76 0.16
77 0.21
78 0.26
79 0.25
80 0.22
81 0.23
82 0.23
83 0.2
84 0.19
85 0.15
86 0.14
87 0.13
88 0.13
89 0.11
90 0.11
91 0.15
92 0.15
93 0.14
94 0.11
95 0.11
96 0.12
97 0.13
98 0.12
99 0.08
100 0.08
101 0.07
102 0.08
103 0.07
104 0.07
105 0.07
106 0.07
107 0.07
108 0.06
109 0.11
110 0.11
111 0.12
112 0.11
113 0.13
114 0.13
115 0.14
116 0.14
117 0.1
118 0.11
119 0.11
120 0.12
121 0.11
122 0.11
123 0.11
124 0.11
125 0.11
126 0.08
127 0.1
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.07
135 0.06
136 0.08
137 0.08
138 0.09
139 0.09
140 0.09
141 0.09
142 0.09
143 0.1
144 0.09
145 0.08
146 0.07
147 0.07
148 0.06
149 0.06
150 0.06
151 0.06
152 0.09
153 0.11
154 0.15
155 0.17
156 0.17
157 0.17
158 0.21
159 0.25
160 0.29
161 0.32
162 0.34
163 0.4
164 0.42
165 0.43
166 0.4
167 0.38
168 0.38
169 0.4
170 0.43
171 0.45
172 0.51
173 0.53
174 0.63
175 0.64
176 0.63
177 0.66
178 0.67
179 0.69
180 0.72
181 0.76
182 0.76
183 0.8
184 0.82
185 0.81
186 0.76
187 0.74
188 0.74
189 0.71
190 0.71
191 0.66
192 0.61
193 0.53
194 0.48
195 0.4
196 0.3
197 0.29
198 0.19
199 0.18
200 0.17
201 0.15
202 0.14
203 0.13
204 0.13
205 0.07
206 0.07
207 0.06
208 0.07
209 0.08
210 0.1
211 0.1
212 0.11
213 0.15
214 0.16
215 0.17
216 0.17
217 0.2