Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2S6B8

Protein Details
Accession A0A5C2S6B8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
104-124QEKHQKLEPRARTRIRCQFRVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 4, extr 15, mito 8, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MCPGRGKTPFPLSSPFSLLSSVFCGEPWRSVGHGACRPIPASDDLGSCVRAAVGWRISRSNGIGIVSRTRRRGADPERDLPVESGQVHAHSTRLDLDARSYPLQEKHQKLEPRARTRIRCQFRVADRVCIGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.39
3 0.31
4 0.28
5 0.25
6 0.21
7 0.19
8 0.17
9 0.13
10 0.12
11 0.14
12 0.14
13 0.16
14 0.16
15 0.15
16 0.15
17 0.18
18 0.2
19 0.25
20 0.28
21 0.29
22 0.29
23 0.29
24 0.29
25 0.26
26 0.25
27 0.2
28 0.18
29 0.17
30 0.16
31 0.17
32 0.17
33 0.17
34 0.14
35 0.12
36 0.09
37 0.08
38 0.08
39 0.09
40 0.12
41 0.14
42 0.15
43 0.16
44 0.17
45 0.18
46 0.18
47 0.15
48 0.12
49 0.11
50 0.11
51 0.11
52 0.16
53 0.2
54 0.22
55 0.23
56 0.23
57 0.24
58 0.25
59 0.33
60 0.35
61 0.41
62 0.43
63 0.46
64 0.47
65 0.47
66 0.44
67 0.36
68 0.3
69 0.21
70 0.16
71 0.14
72 0.11
73 0.11
74 0.12
75 0.11
76 0.11
77 0.09
78 0.1
79 0.1
80 0.11
81 0.12
82 0.11
83 0.14
84 0.17
85 0.2
86 0.2
87 0.2
88 0.22
89 0.25
90 0.34
91 0.4
92 0.41
93 0.42
94 0.5
95 0.55
96 0.59
97 0.64
98 0.66
99 0.66
100 0.71
101 0.75
102 0.75
103 0.78
104 0.83
105 0.81
106 0.76
107 0.72
108 0.72
109 0.7
110 0.73
111 0.65
112 0.63