Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4TX62

Protein Details
Accession G4TX62    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-37RSSSHKRRATGGHRPHYRKKRKFELGRQPASTKBasic
NLS Segment(s)
PositionSequence
9-43HKRRATGGHRPHYRKKRKFELGRQPASTKLGAKRI
Subcellular Location(s) nucl 13, mito_nucl 10.833, cyto_nucl 10.333, mito 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
IPR018283  Ribosomal_S8e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
PROSITE View protein in PROSITE  
PS01193  RIBOSOMAL_S8E  
CDD cd11380  Ribosomal_S8e_like  
Amino Acid Sequences MGISRSSSHKRRATGGHRPHYRKKRKFELGRQPASTKLGAKRIHTVRTRGGNTKYRALRLDSGNYAWGSESVTCKTRIISVNYNASNNELVRTNTLVKGAVIQVDATPFRQWYESHYDDRGEEATVGIDKEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.72
4 0.76
5 0.81
6 0.85
7 0.86
8 0.88
9 0.87
10 0.86
11 0.86
12 0.87
13 0.9
14 0.9
15 0.9
16 0.9
17 0.88
18 0.82
19 0.72
20 0.64
21 0.57
22 0.48
23 0.41
24 0.35
25 0.36
26 0.35
27 0.35
28 0.41
29 0.42
30 0.48
31 0.47
32 0.47
33 0.45
34 0.5
35 0.52
36 0.49
37 0.51
38 0.51
39 0.5
40 0.54
41 0.5
42 0.44
43 0.42
44 0.39
45 0.37
46 0.32
47 0.32
48 0.25
49 0.24
50 0.23
51 0.21
52 0.18
53 0.13
54 0.11
55 0.08
56 0.08
57 0.09
58 0.09
59 0.11
60 0.12
61 0.12
62 0.12
63 0.16
64 0.19
65 0.22
66 0.27
67 0.29
68 0.35
69 0.36
70 0.37
71 0.32
72 0.3
73 0.27
74 0.21
75 0.18
76 0.13
77 0.12
78 0.13
79 0.15
80 0.16
81 0.15
82 0.16
83 0.15
84 0.13
85 0.14
86 0.13
87 0.12
88 0.1
89 0.09
90 0.09
91 0.11
92 0.12
93 0.11
94 0.12
95 0.11
96 0.12
97 0.14
98 0.14
99 0.17
100 0.25
101 0.28
102 0.31
103 0.33
104 0.33
105 0.32
106 0.34
107 0.3
108 0.22
109 0.18
110 0.14
111 0.13
112 0.13
113 0.13