Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SBU1

Protein Details
Accession A0A5C2SBU1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-55NSKHKTRRSWLPNVHNKRLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
IPR001383  Ribosomal_L28  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences MFPSSSFWAVVSAPFKRSQLGLFQGKTKLYGNSVPNSKHKTRRSWLPNVHNKRLFSDALQQHLRIKLTTRALKTIKKHGGVDNYLLKTKPELLGWEGMRLRVMVREKQQASPVEEIAKVDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.25
5 0.22
6 0.24
7 0.29
8 0.33
9 0.32
10 0.36
11 0.37
12 0.37
13 0.37
14 0.32
15 0.26
16 0.22
17 0.27
18 0.27
19 0.3
20 0.35
21 0.36
22 0.41
23 0.47
24 0.5
25 0.53
26 0.56
27 0.58
28 0.59
29 0.66
30 0.67
31 0.69
32 0.72
33 0.73
34 0.78
35 0.77
36 0.8
37 0.74
38 0.67
39 0.59
40 0.53
41 0.43
42 0.34
43 0.35
44 0.28
45 0.29
46 0.29
47 0.27
48 0.26
49 0.27
50 0.26
51 0.18
52 0.18
53 0.18
54 0.24
55 0.29
56 0.28
57 0.32
58 0.36
59 0.41
60 0.43
61 0.48
62 0.47
63 0.45
64 0.46
65 0.44
66 0.46
67 0.43
68 0.44
69 0.4
70 0.36
71 0.35
72 0.32
73 0.28
74 0.23
75 0.24
76 0.21
77 0.15
78 0.16
79 0.16
80 0.23
81 0.23
82 0.27
83 0.26
84 0.24
85 0.24
86 0.21
87 0.19
88 0.19
89 0.24
90 0.24
91 0.3
92 0.39
93 0.41
94 0.45
95 0.51
96 0.5
97 0.5
98 0.47
99 0.43
100 0.36
101 0.34