Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2RY93

Protein Details
Accession A0A5C2RY93    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-24PEDGNCRRKVRHRIDHHQVVQSCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 2, cyto 2, plas 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MPEDGNCRRKVRHRIDHHQVVQSCFCLLFILLSREVLVTCFQLECHYAKYLPIAQFRSDAAKATCDSYGGNSTLIPNPQSAETRTGSHSYLCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.88
4 0.83
5 0.8
6 0.72
7 0.65
8 0.56
9 0.46
10 0.37
11 0.26
12 0.21
13 0.14
14 0.11
15 0.08
16 0.08
17 0.11
18 0.1
19 0.11
20 0.11
21 0.1
22 0.1
23 0.1
24 0.09
25 0.06
26 0.06
27 0.06
28 0.06
29 0.07
30 0.09
31 0.09
32 0.1
33 0.1
34 0.1
35 0.1
36 0.12
37 0.16
38 0.18
39 0.22
40 0.22
41 0.22
42 0.23
43 0.23
44 0.25
45 0.21
46 0.2
47 0.16
48 0.16
49 0.16
50 0.17
51 0.16
52 0.13
53 0.12
54 0.13
55 0.15
56 0.13
57 0.13
58 0.12
59 0.14
60 0.17
61 0.18
62 0.17
63 0.14
64 0.15
65 0.17
66 0.2
67 0.2
68 0.22
69 0.22
70 0.24
71 0.27
72 0.28
73 0.27