Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2S453

Protein Details
Accession A0A5C2S453    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
149-178RGPASDLPAKNKKNKKNKKNKKNKKKTDTSBasic
NLS Segment(s)
PositionSequence
148-174RRGPASDLPAKNKKNKKNKKNKKNKKK
Subcellular Location(s) nucl 15, cyto_nucl 11.833, mito_nucl 10.333, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MSYNPYTKAPPIPKSLPSHKNPLYGFLPRNVTAKQVQAAMGSDTNPFTKKPHSPQYKKILEARKKLPVFSQMDEFLKMFTNNQIIVMVGETGSGKTTQIPQFVCYSDLPHTKGQMVACTQPRRVAAIIGRDEAGAVEGAEEAFAQVRRRGPASDLPAKNKKNKKNKKNKKNKKKTDTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.66
4 0.63
5 0.67
6 0.63
7 0.66
8 0.59
9 0.57
10 0.52
11 0.5
12 0.47
13 0.42
14 0.43
15 0.38
16 0.4
17 0.35
18 0.34
19 0.29
20 0.3
21 0.26
22 0.23
23 0.21
24 0.19
25 0.2
26 0.18
27 0.16
28 0.14
29 0.13
30 0.13
31 0.14
32 0.14
33 0.14
34 0.14
35 0.19
36 0.26
37 0.33
38 0.42
39 0.52
40 0.57
41 0.65
42 0.73
43 0.73
44 0.69
45 0.69
46 0.69
47 0.66
48 0.67
49 0.63
50 0.62
51 0.58
52 0.55
53 0.49
54 0.47
55 0.43
56 0.37
57 0.35
58 0.28
59 0.28
60 0.28
61 0.26
62 0.18
63 0.15
64 0.14
65 0.11
66 0.1
67 0.11
68 0.1
69 0.1
70 0.09
71 0.08
72 0.08
73 0.08
74 0.06
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.1
84 0.12
85 0.16
86 0.16
87 0.17
88 0.19
89 0.19
90 0.21
91 0.16
92 0.16
93 0.17
94 0.2
95 0.22
96 0.21
97 0.22
98 0.2
99 0.22
100 0.21
101 0.19
102 0.18
103 0.2
104 0.26
105 0.29
106 0.29
107 0.3
108 0.3
109 0.3
110 0.28
111 0.26
112 0.22
113 0.26
114 0.27
115 0.25
116 0.25
117 0.22
118 0.21
119 0.17
120 0.15
121 0.07
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.06
130 0.08
131 0.1
132 0.13
133 0.17
134 0.19
135 0.22
136 0.23
137 0.25
138 0.31
139 0.38
140 0.44
141 0.46
142 0.52
143 0.6
144 0.65
145 0.71
146 0.72
147 0.74
148 0.76
149 0.82
150 0.85
151 0.87
152 0.92
153 0.94
154 0.96
155 0.97
156 0.97
157 0.98
158 0.98