Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2SPU1

Protein Details
Accession A0A5C2SPU1    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
109-133YSIHCRNSLKPKRRAWRSSGKRTCTHydrophilic
NLS Segment(s)
PositionSequence
119-125PKRRAWR
167-171GRRRR
Subcellular Location(s) nucl 15, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MMGPPLALRYANSTGLMRSTSPQFHPSLHLQATTNYLLDTGWSFLSAQSHSATVLETQRNLTSSAQLTESERAQIHGNSLASSALYCERQEDEPRSMLVGHLTVVDSIYSIHCRNSLKPKRRAWRSSGKRTCTAGKHWEHRLRTLPDISPHMSPVGEPGPSQRLTRGRRRRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.23
4 0.17
5 0.17
6 0.2
7 0.23
8 0.25
9 0.28
10 0.28
11 0.28
12 0.32
13 0.33
14 0.35
15 0.32
16 0.31
17 0.28
18 0.28
19 0.3
20 0.26
21 0.22
22 0.15
23 0.14
24 0.12
25 0.11
26 0.11
27 0.08
28 0.07
29 0.07
30 0.07
31 0.08
32 0.1
33 0.1
34 0.11
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.14
42 0.14
43 0.14
44 0.15
45 0.16
46 0.17
47 0.18
48 0.16
49 0.14
50 0.14
51 0.15
52 0.14
53 0.14
54 0.15
55 0.15
56 0.15
57 0.14
58 0.13
59 0.13
60 0.13
61 0.13
62 0.12
63 0.13
64 0.13
65 0.11
66 0.11
67 0.1
68 0.08
69 0.08
70 0.07
71 0.06
72 0.07
73 0.06
74 0.07
75 0.09
76 0.11
77 0.15
78 0.17
79 0.19
80 0.19
81 0.19
82 0.18
83 0.17
84 0.15
85 0.12
86 0.09
87 0.06
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.04
94 0.05
95 0.05
96 0.08
97 0.08
98 0.09
99 0.12
100 0.14
101 0.19
102 0.3
103 0.39
104 0.47
105 0.55
106 0.64
107 0.72
108 0.8
109 0.81
110 0.78
111 0.79
112 0.79
113 0.82
114 0.81
115 0.77
116 0.72
117 0.7
118 0.69
119 0.62
120 0.59
121 0.57
122 0.56
123 0.57
124 0.62
125 0.66
126 0.62
127 0.63
128 0.65
129 0.6
130 0.57
131 0.54
132 0.48
133 0.45
134 0.47
135 0.44
136 0.37
137 0.33
138 0.29
139 0.24
140 0.2
141 0.2
142 0.17
143 0.16
144 0.15
145 0.18
146 0.23
147 0.25
148 0.26
149 0.29
150 0.35
151 0.42
152 0.53