Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2SLC3

Protein Details
Accession A0A5C2SLC3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
6-31TSSPSAWRCRNRACRHGRPMRPSPLPHydrophilic
NLS Segment(s)
PositionSequence
35-51PHKPRAGATARGRPKIR
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
Amino Acid Sequences MLSSITSSPSAWRCRNRACRHGRPMRPSPLPTSLPHKPRAGATARGRPKIRRCSPSHGRLDAPMTARRLSQTAAGSCVVGLRLLVRAGSEMSFASAADAQTVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.69
3 0.72
4 0.76
5 0.78
6 0.81
7 0.84
8 0.87
9 0.85
10 0.83
11 0.83
12 0.81
13 0.77
14 0.69
15 0.64
16 0.6
17 0.54
18 0.48
19 0.47
20 0.45
21 0.44
22 0.46
23 0.42
24 0.37
25 0.35
26 0.38
27 0.34
28 0.35
29 0.36
30 0.41
31 0.45
32 0.49
33 0.51
34 0.52
35 0.56
36 0.58
37 0.6
38 0.59
39 0.59
40 0.62
41 0.69
42 0.71
43 0.69
44 0.61
45 0.54
46 0.47
47 0.45
48 0.38
49 0.33
50 0.27
51 0.23
52 0.21
53 0.21
54 0.2
55 0.19
56 0.17
57 0.18
58 0.19
59 0.17
60 0.19
61 0.19
62 0.18
63 0.16
64 0.16
65 0.12
66 0.08
67 0.07
68 0.05
69 0.06
70 0.07
71 0.07
72 0.07
73 0.07
74 0.09
75 0.09
76 0.09
77 0.08
78 0.09
79 0.09
80 0.09
81 0.1
82 0.11
83 0.1