Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4T7I7

Protein Details
Accession G4T7I7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-75GFSPYERRDKKARKLTKKRLGTLLRBasic
NLS Segment(s)
PositionSequence
24-39KVARPAHRKGKLSERN
57-79RRDKKARKLTKKRLGTLLRSKRK
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
Amino Acid Sequences MAPTTRNNLRVGLNKGRSVTAIPKVARPAHRKGKLSERNKFVRSVVREVVGFSPYERRDKKARKLTKKRLGTLLRSKRKVEELQTIIQETRKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.45
4 0.4
5 0.36
6 0.34
7 0.3
8 0.32
9 0.3
10 0.31
11 0.36
12 0.41
13 0.46
14 0.45
15 0.49
16 0.52
17 0.59
18 0.59
19 0.58
20 0.64
21 0.66
22 0.69
23 0.68
24 0.64
25 0.64
26 0.62
27 0.59
28 0.5
29 0.48
30 0.43
31 0.39
32 0.33
33 0.27
34 0.26
35 0.25
36 0.24
37 0.18
38 0.14
39 0.1
40 0.15
41 0.16
42 0.24
43 0.24
44 0.27
45 0.37
46 0.46
47 0.56
48 0.6
49 0.69
50 0.72
51 0.82
52 0.89
53 0.89
54 0.89
55 0.84
56 0.83
57 0.79
58 0.77
59 0.76
60 0.76
61 0.76
62 0.73
63 0.7
64 0.65
65 0.66
66 0.63
67 0.58
68 0.57
69 0.52
70 0.53
71 0.53
72 0.52
73 0.46