Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2S433

Protein Details
Accession A0A5C2S433   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-108ATPQHKTLPPRYRARRDERRLRRTLDRCBasic
NLS Segment(s)
PositionSequence
92-103YRARRDERRLRR
Subcellular Location(s) cyto 5.5, cyto_nucl 13, nucl 19.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018859  BAR_dom-cont  
Pfam View protein in Pfam  
PF10455  BAR_2  
Amino Acid Sequences MSALFPPSRRQELHQATSSVQTGQVTKVYETEPYDYPTHLQESITELGTTIGHGIANFAAANLKGTNLPTPAPAPAPVEAATPQHKTLPPRYRARRDERRLRRTLDRCRQRGQARQGPHILGRRLRTRVSSRTLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.51
3 0.47
4 0.48
5 0.44
6 0.34
7 0.26
8 0.2
9 0.17
10 0.16
11 0.18
12 0.16
13 0.15
14 0.17
15 0.16
16 0.18
17 0.19
18 0.21
19 0.19
20 0.21
21 0.22
22 0.21
23 0.21
24 0.2
25 0.2
26 0.17
27 0.16
28 0.13
29 0.16
30 0.17
31 0.16
32 0.14
33 0.12
34 0.12
35 0.11
36 0.11
37 0.07
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.06
51 0.06
52 0.06
53 0.08
54 0.08
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.1
61 0.1
62 0.1
63 0.11
64 0.11
65 0.11
66 0.11
67 0.13
68 0.15
69 0.15
70 0.16
71 0.17
72 0.2
73 0.23
74 0.32
75 0.39
76 0.43
77 0.52
78 0.61
79 0.67
80 0.74
81 0.8
82 0.82
83 0.82
84 0.86
85 0.86
86 0.87
87 0.83
88 0.8
89 0.8
90 0.78
91 0.8
92 0.79
93 0.79
94 0.75
95 0.74
96 0.78
97 0.75
98 0.76
99 0.75
100 0.72
101 0.67
102 0.68
103 0.67
104 0.61
105 0.59
106 0.57
107 0.53
108 0.51
109 0.52
110 0.53
111 0.53
112 0.53
113 0.55
114 0.55
115 0.57