Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4TL59

Protein Details
Accession G4TL59    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
13-37TKTHTLCRRCGRRAFHRQHKTCASCHydrophilic
NLS Segment(s)
PositionSequence
52-78KAKRRKTTGTGRMRYLRHVSRKFKNGF
Subcellular Location(s) mito 11, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTSSFGKRHTKTHTLCRRCGRRAFHRQHKTCASCGYPSAKIRSYEWGQKAKRRKTTGTGRMRYLRHVSRKFKNGFRENTVAKRKVTAAKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.71
4 0.67
5 0.73
6 0.77
7 0.77
8 0.75
9 0.77
10 0.75
11 0.74
12 0.78
13 0.81
14 0.81
15 0.83
16 0.8
17 0.8
18 0.81
19 0.73
20 0.64
21 0.58
22 0.49
23 0.39
24 0.37
25 0.34
26 0.29
27 0.29
28 0.3
29 0.29
30 0.28
31 0.28
32 0.31
33 0.3
34 0.32
35 0.35
36 0.4
37 0.39
38 0.45
39 0.54
40 0.56
41 0.62
42 0.6
43 0.59
44 0.59
45 0.67
46 0.7
47 0.71
48 0.67
49 0.64
50 0.66
51 0.63
52 0.6
53 0.57
54 0.55
55 0.54
56 0.59
57 0.62
58 0.64
59 0.72
60 0.73
61 0.72
62 0.75
63 0.73
64 0.7
65 0.69
66 0.69
67 0.64
68 0.68
69 0.71
70 0.64
71 0.56
72 0.53
73 0.51
74 0.52