Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2S9A4

Protein Details
Accession A0A5C2S9A4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-63PSPSPSSSKSQPKPKPKKDYAAAHydrophilic
NLS Segment(s)
PositionSequence
91-112EKKRLAKEAKALEKARRKEAKA
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 3
Family & Domain DBs
Amino Acid Sequences MPSRTSSSSLPSAPSMVSVTSTTTCASSSTSASSTPTLTAPSPSPSSSKSQPKPKPKKDYAAAFTAMQLEYGWGHHTFVPIESAAVKEAQEKKRLAKEAKALEKARRKEAKAAGALESEQGQPPRTGKDYESAFGALSSKMGWGSWMPSPGPRKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.19
3 0.14
4 0.14
5 0.12
6 0.14
7 0.13
8 0.15
9 0.14
10 0.13
11 0.13
12 0.12
13 0.13
14 0.12
15 0.12
16 0.14
17 0.14
18 0.14
19 0.16
20 0.16
21 0.15
22 0.14
23 0.14
24 0.13
25 0.13
26 0.14
27 0.14
28 0.17
29 0.18
30 0.18
31 0.2
32 0.2
33 0.25
34 0.31
35 0.39
36 0.43
37 0.52
38 0.6
39 0.69
40 0.78
41 0.83
42 0.85
43 0.81
44 0.83
45 0.79
46 0.78
47 0.7
48 0.63
49 0.55
50 0.44
51 0.38
52 0.31
53 0.24
54 0.15
55 0.11
56 0.08
57 0.06
58 0.06
59 0.08
60 0.06
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.09
67 0.07
68 0.07
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.11
75 0.19
76 0.22
77 0.28
78 0.29
79 0.33
80 0.39
81 0.46
82 0.43
83 0.4
84 0.44
85 0.47
86 0.53
87 0.56
88 0.53
89 0.54
90 0.61
91 0.59
92 0.61
93 0.59
94 0.55
95 0.55
96 0.58
97 0.57
98 0.53
99 0.51
100 0.43
101 0.37
102 0.35
103 0.27
104 0.23
105 0.17
106 0.15
107 0.15
108 0.14
109 0.15
110 0.17
111 0.21
112 0.22
113 0.23
114 0.22
115 0.28
116 0.3
117 0.29
118 0.29
119 0.25
120 0.22
121 0.2
122 0.2
123 0.13
124 0.1
125 0.1
126 0.08
127 0.08
128 0.07
129 0.08
130 0.08
131 0.12
132 0.15
133 0.18
134 0.18
135 0.25