Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2T375

Protein Details
Accession A0A5C2T375   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
149-175ESEWNPPKKLKQPKPTRWQQRNMKKGLHydrophilic
NLS Segment(s)
PositionSequence
156-162KKLKQPK
Subcellular Location(s) cyto 8, mito 3, nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR023251  Brr1  
IPR035426  Gemin2/Brr1  
Gene Ontology GO:0030532  C:small nuclear ribonucleoprotein complex  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF04938  SIP1  
Amino Acid Sequences MSHAIKRKAEELEDSDDEEPMLGRQVLPVANLPDTFDGVPMDGMQYLFTVRRDARSLPHVTRVVNPYELPDVPAPSAEALAVGADSGPSHKAILPSEEWRETFLRRFKNFRKNSTQPTIHVHIPDYSSKVMPDKKERDLWWAFLAGRPESEWNPPKKLKQPKPTRWQQRNMKKGLAVREEAPDDAVLPYDVSDVHSESPRAPTGPPFATPSTTPRDLPLPSPLVPDPRAGELSTSDPKLMDAEDGEILPLVYLPREPTPALMQHIDHRYALHLLMYFGHWIERRLEEGRLPYTEITQSHGRWIFSLLSRVDDWISGDETSLLRGLARGCMGLVAETRRRSIAADGIKAGDAAELIDERSCWMIITAITGLWGQTDLWADAESILCKLEQDGQERAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.38
3 0.33
4 0.29
5 0.23
6 0.19
7 0.11
8 0.13
9 0.1
10 0.09
11 0.1
12 0.14
13 0.14
14 0.15
15 0.19
16 0.18
17 0.2
18 0.2
19 0.21
20 0.19
21 0.2
22 0.19
23 0.16
24 0.14
25 0.12
26 0.12
27 0.11
28 0.1
29 0.09
30 0.09
31 0.08
32 0.08
33 0.09
34 0.11
35 0.12
36 0.17
37 0.17
38 0.21
39 0.24
40 0.26
41 0.3
42 0.35
43 0.42
44 0.39
45 0.46
46 0.45
47 0.43
48 0.47
49 0.46
50 0.42
51 0.37
52 0.34
53 0.29
54 0.3
55 0.29
56 0.25
57 0.23
58 0.21
59 0.19
60 0.19
61 0.17
62 0.13
63 0.13
64 0.09
65 0.08
66 0.06
67 0.05
68 0.05
69 0.04
70 0.03
71 0.03
72 0.03
73 0.05
74 0.06
75 0.06
76 0.07
77 0.09
78 0.12
79 0.13
80 0.17
81 0.19
82 0.23
83 0.28
84 0.29
85 0.28
86 0.29
87 0.3
88 0.28
89 0.32
90 0.35
91 0.39
92 0.41
93 0.5
94 0.57
95 0.65
96 0.7
97 0.71
98 0.74
99 0.73
100 0.77
101 0.78
102 0.72
103 0.64
104 0.63
105 0.59
106 0.51
107 0.45
108 0.37
109 0.3
110 0.28
111 0.27
112 0.23
113 0.2
114 0.18
115 0.18
116 0.22
117 0.25
118 0.28
119 0.35
120 0.38
121 0.41
122 0.47
123 0.48
124 0.5
125 0.47
126 0.44
127 0.36
128 0.33
129 0.28
130 0.24
131 0.25
132 0.17
133 0.16
134 0.14
135 0.15
136 0.15
137 0.22
138 0.27
139 0.29
140 0.36
141 0.39
142 0.43
143 0.5
144 0.59
145 0.61
146 0.65
147 0.72
148 0.75
149 0.82
150 0.87
151 0.89
152 0.87
153 0.87
154 0.87
155 0.86
156 0.85
157 0.78
158 0.71
159 0.63
160 0.58
161 0.55
162 0.48
163 0.4
164 0.32
165 0.3
166 0.29
167 0.25
168 0.21
169 0.14
170 0.11
171 0.09
172 0.08
173 0.05
174 0.04
175 0.05
176 0.04
177 0.05
178 0.05
179 0.06
180 0.06
181 0.08
182 0.09
183 0.09
184 0.09
185 0.12
186 0.11
187 0.11
188 0.11
189 0.12
190 0.15
191 0.16
192 0.16
193 0.18
194 0.18
195 0.18
196 0.19
197 0.2
198 0.22
199 0.22
200 0.21
201 0.19
202 0.22
203 0.21
204 0.22
205 0.23
206 0.2
207 0.19
208 0.21
209 0.21
210 0.22
211 0.22
212 0.22
213 0.19
214 0.17
215 0.18
216 0.15
217 0.15
218 0.12
219 0.16
220 0.17
221 0.16
222 0.15
223 0.14
224 0.14
225 0.14
226 0.12
227 0.09
228 0.06
229 0.07
230 0.07
231 0.07
232 0.07
233 0.06
234 0.06
235 0.05
236 0.05
237 0.04
238 0.04
239 0.04
240 0.06
241 0.07
242 0.1
243 0.1
244 0.11
245 0.14
246 0.16
247 0.19
248 0.19
249 0.18
250 0.22
251 0.26
252 0.26
253 0.23
254 0.21
255 0.2
256 0.19
257 0.18
258 0.14
259 0.11
260 0.09
261 0.1
262 0.1
263 0.09
264 0.08
265 0.11
266 0.11
267 0.12
268 0.14
269 0.14
270 0.17
271 0.19
272 0.2
273 0.2
274 0.23
275 0.25
276 0.23
277 0.24
278 0.21
279 0.21
280 0.23
281 0.2
282 0.21
283 0.23
284 0.22
285 0.27
286 0.3
287 0.28
288 0.25
289 0.27
290 0.26
291 0.23
292 0.29
293 0.22
294 0.22
295 0.22
296 0.22
297 0.2
298 0.17
299 0.17
300 0.13
301 0.14
302 0.11
303 0.11
304 0.12
305 0.11
306 0.12
307 0.11
308 0.09
309 0.07
310 0.09
311 0.09
312 0.1
313 0.11
314 0.1
315 0.09
316 0.1
317 0.1
318 0.1
319 0.12
320 0.15
321 0.21
322 0.22
323 0.24
324 0.24
325 0.25
326 0.25
327 0.25
328 0.27
329 0.28
330 0.29
331 0.29
332 0.3
333 0.29
334 0.27
335 0.24
336 0.17
337 0.1
338 0.07
339 0.07
340 0.06
341 0.07
342 0.07
343 0.07
344 0.08
345 0.1
346 0.1
347 0.08
348 0.08
349 0.09
350 0.09
351 0.12
352 0.11
353 0.1
354 0.11
355 0.11
356 0.1
357 0.09
358 0.1
359 0.07
360 0.08
361 0.1
362 0.1
363 0.11
364 0.12
365 0.11
366 0.12
367 0.14
368 0.12
369 0.11
370 0.11
371 0.1
372 0.1
373 0.11
374 0.17
375 0.21
376 0.25
377 0.28