Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2RUF8

Protein Details
Accession A0A5C2RUF8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-48ASLCRCHRRARTPSRRPHSTMHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 2, extr 6, mito 13, plas 3, vacu 2
Family & Domain DBs
Amino Acid Sequences MDNLHFSRTTGGSSLGVTQAGPLPTPGASLCRCHRRARTPSRRPHSTMFIRSSRPERLHQTTLAFPVLLGDLVVVGCVPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.13
4 0.11
5 0.1
6 0.11
7 0.11
8 0.1
9 0.09
10 0.09
11 0.09
12 0.1
13 0.09
14 0.1
15 0.11
16 0.15
17 0.21
18 0.29
19 0.32
20 0.37
21 0.44
22 0.49
23 0.58
24 0.65
25 0.71
26 0.72
27 0.79
28 0.81
29 0.8
30 0.75
31 0.69
32 0.66
33 0.61
34 0.58
35 0.54
36 0.49
37 0.47
38 0.46
39 0.47
40 0.46
41 0.43
42 0.41
43 0.44
44 0.47
45 0.48
46 0.47
47 0.45
48 0.41
49 0.4
50 0.35
51 0.27
52 0.19
53 0.17
54 0.15
55 0.11
56 0.08
57 0.06
58 0.05
59 0.05
60 0.05