Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2RZR0

Protein Details
Accession A0A5C2RZR0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-34ESLFRLGRARKRQKVRWEEFVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 4.5, cyto_mito 14, mito 22.5
Family & Domain DBs
Amino Acid Sequences MASKLTKRDVQVFESLFRLGRARKRQKVRWEEFVLAMTHFGFACGTGGGHSGSVRTFTSPASMGGTTVTLDESKPMPQPPRPGKTCQTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.26
4 0.23
5 0.23
6 0.21
7 0.28
8 0.38
9 0.46
10 0.55
11 0.64
12 0.72
13 0.79
14 0.84
15 0.81
16 0.8
17 0.74
18 0.67
19 0.58
20 0.52
21 0.41
22 0.3
23 0.25
24 0.15
25 0.11
26 0.08
27 0.07
28 0.05
29 0.04
30 0.05
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.07
41 0.07
42 0.07
43 0.08
44 0.08
45 0.1
46 0.1
47 0.11
48 0.12
49 0.12
50 0.11
51 0.11
52 0.11
53 0.09
54 0.09
55 0.09
56 0.06
57 0.06
58 0.08
59 0.09
60 0.11
61 0.15
62 0.2
63 0.25
64 0.3
65 0.41
66 0.49
67 0.57
68 0.59
69 0.63