Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SE50

Protein Details
Accession A0A5C2SE50    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-36TSSSGGKAAKKKKWSKGKVKDKAQHAVHydrophilic
NLS Segment(s)
PositionSequence
12-31SSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MGAKAKAAPTSSSGGKAAKKKKWSKGKVKDKAQHAVVLDKPTYDRILKEVPTFRFISQSILIERLKINGSLARVAIRHLEKEGQIKRIVHHSGQLIYSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.38
4 0.44
5 0.47
6 0.56
7 0.62
8 0.7
9 0.77
10 0.81
11 0.84
12 0.86
13 0.9
14 0.89
15 0.91
16 0.88
17 0.83
18 0.8
19 0.7
20 0.62
21 0.52
22 0.46
23 0.39
24 0.34
25 0.28
26 0.21
27 0.2
28 0.18
29 0.19
30 0.15
31 0.13
32 0.13
33 0.16
34 0.17
35 0.21
36 0.25
37 0.24
38 0.26
39 0.28
40 0.24
41 0.24
42 0.23
43 0.22
44 0.18
45 0.19
46 0.16
47 0.18
48 0.18
49 0.17
50 0.17
51 0.15
52 0.15
53 0.13
54 0.13
55 0.12
56 0.13
57 0.13
58 0.14
59 0.14
60 0.13
61 0.14
62 0.19
63 0.18
64 0.18
65 0.19
66 0.22
67 0.23
68 0.32
69 0.36
70 0.34
71 0.37
72 0.37
73 0.38
74 0.43
75 0.44
76 0.37
77 0.37
78 0.37
79 0.34