Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2RZ30

Protein Details
Accession A0A5C2RZ30   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
208-234QVRHSTAPGKPKRGRPPRSYVPPHSTPHydrophilic
NLS Segment(s)
PositionSequence
216-224GKPKRGRPP
Subcellular Location(s) cyto 4, cyto_nucl 9, mito 9, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR018608  Gti1/Pac2  
Pfam View protein in Pfam  
PF09729  Gti1_Pac2  
Amino Acid Sequences MSHGAAHAFAPASTTTTPTTPTKPEILRGWVKTTRDAMLVFEATRVGIVPRVTRRFHELEKRSIIRSGAIFVFTEEESGIKRWTDPYLWSASRMQGNFLMYRERDDEHGPQMDSPYRCSAMSSFTEYAELLDPELEHYILGSWNKGKGLKKNGLMKKAISISIEGTVYHLISYYYPSDVRSGVLQTPSSMPHLASLELSPAIMRSFSQVRHSTAPGKPKRGRPPRSYVPPHSTPLHVSCTKAGASSSSRGLPDSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.2
5 0.22
6 0.26
7 0.27
8 0.31
9 0.36
10 0.36
11 0.41
12 0.41
13 0.45
14 0.49
15 0.48
16 0.51
17 0.49
18 0.49
19 0.48
20 0.46
21 0.4
22 0.35
23 0.32
24 0.27
25 0.25
26 0.24
27 0.19
28 0.17
29 0.15
30 0.12
31 0.12
32 0.1
33 0.07
34 0.09
35 0.1
36 0.16
37 0.24
38 0.3
39 0.32
40 0.33
41 0.4
42 0.42
43 0.48
44 0.53
45 0.5
46 0.51
47 0.58
48 0.59
49 0.54
50 0.51
51 0.44
52 0.36
53 0.31
54 0.27
55 0.19
56 0.17
57 0.15
58 0.13
59 0.14
60 0.12
61 0.11
62 0.08
63 0.08
64 0.08
65 0.1
66 0.1
67 0.08
68 0.09
69 0.1
70 0.13
71 0.14
72 0.14
73 0.16
74 0.22
75 0.22
76 0.24
77 0.23
78 0.25
79 0.28
80 0.26
81 0.24
82 0.2
83 0.21
84 0.2
85 0.19
86 0.2
87 0.16
88 0.18
89 0.18
90 0.17
91 0.17
92 0.18
93 0.2
94 0.19
95 0.22
96 0.2
97 0.18
98 0.19
99 0.23
100 0.2
101 0.2
102 0.19
103 0.17
104 0.17
105 0.18
106 0.16
107 0.15
108 0.16
109 0.18
110 0.16
111 0.15
112 0.16
113 0.15
114 0.15
115 0.13
116 0.11
117 0.06
118 0.05
119 0.05
120 0.05
121 0.06
122 0.05
123 0.04
124 0.04
125 0.04
126 0.06
127 0.06
128 0.07
129 0.07
130 0.08
131 0.1
132 0.15
133 0.17
134 0.23
135 0.3
136 0.35
137 0.41
138 0.5
139 0.54
140 0.55
141 0.53
142 0.47
143 0.43
144 0.39
145 0.35
146 0.25
147 0.21
148 0.17
149 0.16
150 0.16
151 0.11
152 0.1
153 0.1
154 0.09
155 0.08
156 0.07
157 0.06
158 0.06
159 0.08
160 0.08
161 0.09
162 0.1
163 0.11
164 0.12
165 0.12
166 0.12
167 0.12
168 0.13
169 0.14
170 0.16
171 0.15
172 0.15
173 0.16
174 0.17
175 0.18
176 0.16
177 0.14
178 0.14
179 0.15
180 0.14
181 0.14
182 0.12
183 0.11
184 0.11
185 0.11
186 0.08
187 0.08
188 0.07
189 0.07
190 0.07
191 0.09
192 0.13
193 0.15
194 0.22
195 0.26
196 0.3
197 0.33
198 0.37
199 0.39
200 0.41
201 0.49
202 0.5
203 0.56
204 0.59
205 0.65
206 0.73
207 0.77
208 0.82
209 0.79
210 0.81
211 0.82
212 0.85
213 0.85
214 0.83
215 0.8
216 0.76
217 0.72
218 0.66
219 0.58
220 0.52
221 0.46
222 0.45
223 0.39
224 0.36
225 0.33
226 0.33
227 0.31
228 0.27
229 0.24
230 0.21
231 0.23
232 0.24
233 0.26
234 0.26
235 0.27